Signaling Pathway
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Not your Region? View all Distributors
| Catalog Num | AP6169 |
|---|---|
| Physical appearance | Sterile filtered colorless clear solution. |
| Formulation | 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol. |
| Amino acid sequence | mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Stability | HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| Source | Escherichia Coli. |
| Transportation method | Shipped with Ice Packs |
