MIF Human His C

Catalog No.: AP3582
Macrophage Migration Inhibitory Factor Human Recombinant, His Tag C-Terminus
MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.
Grouped product items
Product Name Price Stock Qty
MIF Human His C 5µg
$110.00
In stock
MIF Human His C 25µg
$290.00
In stock
MIF Human His C 1mg
$3,960.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3582
Physical appearance Sterile Filtered lyophilized powder.
Formulation Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4.
Amino acid sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH.
Uniprot ACC# P14174
Purity Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Stability Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Transportation method Shipped at Room temp