ProNGF Human

Catalog No.: AP2482
Pro-Nerve Growth Factor Human Recombinant
Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
ProNGF Human 2µg
$110.00
In stock
ProNGF Human 10µg
$290.00
In stock
ProNGF Human 100µg
$2,200.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP2482
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation ProNGF was lyophilized from a 0.2 ?M filtered solution of 20mM PB and 250mM NaCl pH 7.2.
Amino acid sequence MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Uniprot ACC# P01138
Purity Greater than 95.0% as determined by SDS-PAGE.
Stability Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms Human Pro-NGF, ProNGF, NGFB.
Transportation method Shipped at Room temp