Product Data Sheet
PMAP-36
Catalog No. A48493
PMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease.
Chemical Information
| Catalog Num | A48493 |
|---|---|
| M. Wt | 4157.17 |
| Formula | C191H336N62O39S |
| Purity | >98% |
| Storage | at -20 °C 3 years (powder form); at -20 °C 6 months (Solution base) |
| CAS No. | 154338-08-6 |
| Synonyms | Porcine cathelicidin PMAP-36 |
| SMILES |
Biological Activity
| Description | PMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease. |
|---|
RETURN POLICY
Adooq’s Unconditional Return Policy ensures a smooth online shopping experience for our customers. If you are in any way unsatisfied with your purchase, you may return any item(s) within 7 days of receiving it. In the event of product quality issues, either protocol related or product related problems, you may return any item(s) within 365 days from the original purchase date. Please follow the instructions below when returning products.
Adooq’s Unconditional Return Policy ensures a smooth online shopping experience for our customers. If you are in any way unsatisfied with your purchase, you may return any item(s) within 7 days of receiving it. In the event of product quality issues, either protocol related or product related problems, you may return any item(s) within 365 days from the original purchase date. Please follow the instructions below when returning products.
SHIPPING AND STORAGE
Adooq products are transported at room temperature. If you receive the product at room temperature, please rest assured, the Adooq Quality Inspection Department has conducted experiments to verify that the normal temperature placement of one month will not affect the biological activity of powder products. After collecting, please store the product according to the requirements described in the datasheet. Most Adooq products are stable under the recommended conditions.
Adooq products are transported at room temperature. If you receive the product at room temperature, please rest assured, the Adooq Quality Inspection Department has conducted experiments to verify that the normal temperature placement of one month will not affect the biological activity of powder products. After collecting, please store the product according to the requirements described in the datasheet. Most Adooq products are stable under the recommended conditions.
