Product Data Sheet
Met-RANTES (human)
Catalog No. A59539
Met-RANTES (human) is a potent antagonist of the CCR5 chemokine receptor, demonstrating significant inhibitory activity against human MIP-1α and MIP-1β with IC50 values of 5 nM and 2 nM, respectively. This compound has been shown to effectively reduce bone destruction and improve symptoms in models of adjuvant-induced arthritis in rats. Its application in research may provide valuable insights into inflammatory pathways and therapeutic strategies for diseases involving CCR5 signaling.
Chemical Information
| Catalog Num | A59539 |
|---|---|
| M. Wt | 7978.07 |
| Formula | C355H543N97O101S6 |
| Purity | >98% |
| Storage | at -20 °C 3 years (powder form); at -20 °C 6 months (Solution base) |
| CAS No. | 1883816-50-9 |
| Synonyms | MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN |
| SMILES |
Biological Activity
| Description | Met-RANTES (human) is a potent antagonist of the CCR5 chemokine receptor, demonstrating significant inhibitory activity against human MIP-1α and MIP-1β with IC50 values of 5 nM and 2 nM, respectively. This compound has been shown to effectively reduce bone destruction and improve symptoms in models of adjuvant-induced arthritis in rats. Its application in research may provide valuable insights into inflammatory pathways and therapeutic strategies for diseases involving CCR5 signaling. |
|---|
RETURN POLICY
Adooq’s Unconditional Return Policy ensures a smooth online shopping experience for our customers. If you are in any way unsatisfied with your purchase, you may return any item(s) within 7 days of receiving it. In the event of product quality issues, either protocol related or product related problems, you may return any item(s) within 365 days from the original purchase date. Please follow the instructions below when returning products.
Adooq’s Unconditional Return Policy ensures a smooth online shopping experience for our customers. If you are in any way unsatisfied with your purchase, you may return any item(s) within 7 days of receiving it. In the event of product quality issues, either protocol related or product related problems, you may return any item(s) within 365 days from the original purchase date. Please follow the instructions below when returning products.
SHIPPING AND STORAGE
Adooq products are transported at room temperature. If you receive the product at room temperature, please rest assured, the Adooq Quality Inspection Department has conducted experiments to verify that the normal temperature placement of one month will not affect the biological activity of powder products. After collecting, please store the product according to the requirements described in the datasheet. Most Adooq products are stable under the recommended conditions.
Adooq products are transported at room temperature. If you receive the product at room temperature, please rest assured, the Adooq Quality Inspection Department has conducted experiments to verify that the normal temperature placement of one month will not affect the biological activity of powder products. After collecting, please store the product according to the requirements described in the datasheet. Most Adooq products are stable under the recommended conditions.
