Product Data Sheet
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
Catalog No. A67440
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide designed to mimic the C-terminal domain of the α2δ-1 protein, also referred to as the α2δ-1Tat peptide. This peptide is capable of effectively disrupting the interaction between α2δ-1 and N-methyl-D-aspartate receptors (NMDARs) both in vitro and in vivo. It is a valuable tool for research into the mechanisms underlying neuropathic pain, aiding in the exploration of targeted therapeutic interventions.
Chemical Information
| Catalog Num | A67440 |
|---|---|
| M. Wt | 3490.06 |
| Formula | C171H250N40O39 |
| Purity | >98% |
| Storage | at -20 °C 3 years (powder form); at -20 °C 6 months (Solution base) |
| CAS No. | 2279952-25-7 |
| Synonyms | |
| SMILES | C([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC(CNC([C@H](CC2=CC=CC=C2)NC([C@@H](NC([C@@H](NC([C@H](CC=3C=4C(NC3)=CC=CC4)NC([C@@H](NC([C@@H](NC(=O)[C@H]5N(C([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@H](C(C)C)N)=O)CO)=O)=O)CC(C)C)=O)CC(N)=O)=O)CCC5)CO)=O)CC(C)C)=O)=O)CO)=O)[C@H](CC)C)=O)=O)=O)CC(C)C)=O)CCC(N)=O)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)CC(C)C)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC6=CN=CN6)C(N[C@@H](CC7=CC=C(O)C=C7)C(N[C@H](C(N[C@@H](CC=8C=9C(NC8)=CC=CC9)C(O)=O)=O)CC(C)C)=O)=O)=O)CCCNC(=N)N)=O)CO)=O)=O)CO)=O)C(C)C)=O)CC(C)C)=O)C=%10C=%11C(NC%10)=CC=CC%11 |
Biological Activity
| Description | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide designed to mimic the C-terminal domain of the α2δ-1 protein, also referred to as the α2δ-1Tat peptide. This peptide is capable of effectively disrupting the interaction between α2δ-1 and N-methyl-D-aspartate receptors (NMDARs) both in vitro and in vivo. It is a valuable tool for research into the mechanisms underlying neuropathic pain, aiding in the exploration of targeted therapeutic interventions. |
|---|
RETURN POLICY
Adooq’s Unconditional Return Policy ensures a smooth online shopping experience for our customers. If you are in any way unsatisfied with your purchase, you may return any item(s) within 7 days of receiving it. In the event of product quality issues, either protocol related or product related problems, you may return any item(s) within 365 days from the original purchase date. Please follow the instructions below when returning products.
Adooq’s Unconditional Return Policy ensures a smooth online shopping experience for our customers. If you are in any way unsatisfied with your purchase, you may return any item(s) within 7 days of receiving it. In the event of product quality issues, either protocol related or product related problems, you may return any item(s) within 365 days from the original purchase date. Please follow the instructions below when returning products.
SHIPPING AND STORAGE
Adooq products are transported at room temperature. If you receive the product at room temperature, please rest assured, the Adooq Quality Inspection Department has conducted experiments to verify that the normal temperature placement of one month will not affect the biological activity of powder products. After collecting, please store the product according to the requirements described in the datasheet. Most Adooq products are stable under the recommended conditions.
Adooq products are transported at room temperature. If you receive the product at room temperature, please rest assured, the Adooq Quality Inspection Department has conducted experiments to verify that the normal temperature placement of one month will not affect the biological activity of powder products. After collecting, please store the product according to the requirements described in the datasheet. Most Adooq products are stable under the recommended conditions.
