BMP 7 Human, Plant

Name: BMP 7 Human, Plant
SKU: AP5148
Price: 110 USD
Rating: 5 (288 reviews)

Catalog No.: AP5148

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.

Grouped product items
Size	Price	Stock
2µg	$110.00	In stock
10µg	$290.00	In stock
1mg	$15,400.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP5148
Physical appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Amino acid sequence	HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Uniprot ACC#	P18075
Purity	Greater than 97.0% as determined by SDS-PAGE.
Stability	Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source	Nicotiana benthamiana.
Synonyms	Osteogenic Protein 1, BMP-7.
Transportation method	Shipped at Room temp