Eotaxin 2 Human

Catalog No.: AP5639
Eotaxin-2 Human Recombinant (CCL24)
CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
Eotaxin 2 Human 5µg
$110.00
In stock
Eotaxin 2 Human 20µg
$290.00
In stock
Eotaxin 2 Human 1mg
$5,940.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP5639
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Amino acid sequence VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.
Uniprot ACC# O00175
Purity Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Stability Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Transportation method Shipped at Room temp