GH Zebrafish

Catalog No.: AP3504
Somatotropin Zebrafish Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 185 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21.18 kDa. The Zebrafish Recombinant is purified by proprietary chromatographic techniques.
Grouped product items
Size Price Stock Qty
10µg
$110.00
In stock
50µg
$290.00
In stock
1000µg
$5,060.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Protein Information
Catalog NumAP3504
Physical appearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationThe protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3 pH-8.
Amino acid sequenceAQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL SFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
PurityGreater than 99.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.
StabilityLyophilized Zebrafish Growth-Hormone although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
SourceEscherichia Coli.
SynonymsGH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Transportation methodShipped at Room temp