HIV-2 gp-36 397aa

Name: HIV-2 gp-36 397aa
Brand: Adooq Bioscience
SKU: AP6183
Rating: 5 (288 reviews)

Catalog No.: AP6183

HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus.

Grouped product items
Size	Price	Stock
100µg	$330.00	In stock
500µg	$1,320.00	In stock
1000µg	$2,640.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP6183
Physical appearance	Sterile filtered colorless clear solution.
Formulation	0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.
Amino acid sequence	EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC.
Purity	Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.
Stability	HIV-2 gp-36 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source	Escherichia Coli.
Transportation method	Shipped with Ice Packs