RAP Rat

Catalog No.: AP1817
Recombinant Rat Receptor Associated Protein produced in E.Coli is a single, non-glycosylated polypeptide chain containing 327 amino acids and having a molecular mass of 38,862 Dalton. The Recombinant RAP Rat contains 6xHis tag and 1xC-myc, RAP Rat is purified by proprietary chromatographic techniques.
Grouped product items
Size Price Stock Qty
5µg
$110.00
In stock
20µg
$290.00
In stock
1000µg
$6,160.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Protein Information
Catalog NumAP1817
Physical appearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationThe protein (1mg/ml) was lyophilized after from a sterile solution containing TBS pH-7.5, 0.1% BSA and 0.09% NaN3.
Amino acid sequenceMAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL.
PurityGreater than 95.0% as determined by SDS-PAGE.
StabilityLyophilized RAP Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution RAP Rat should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
SourceEscherichia Coli.
SynonymsReceptor Associated Protein, RAP.
Transportation methodShipped at Room temp