Signaling Pathway
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Not your Region? View all Distributors
| Catalog Num | AP6276 |
|---|---|
| Physical appearance | Sterile filtered clear solution. |
| Formulation | SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. |
| Amino acid sequence | EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH. |
| Uniprot ACC# | AHC74088 |
| Purity | Protein is >95% pure as determined by 12% PAGE (coomassie staining). |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Transportation method | Shipped with Ice Packs |
