5-TAMRA-Amyloid β-Protein (1-40)

Catalog No.: A78348
Amyloid β-Protein (1-40) Fluorescence
5-TAMRA-Amyloid β-Protein (1-40) is a fluorescently labeled peptide targeting the Amyloid β-Protein (1-40) with an excitation/emission wavelength of 544/572 nm. This reagent is designed for the study of amyloid aggregation, facilitating the investigation of Alzheimer's disease pathology. Its fluorescence properties make it suitable for applications in live-cell imaging and fluorescence microscopy, enabling researchers to track amyloid formation and accumulation in various biological contexts.
Grouped product items
Size Stock
5mg
10mg
50mg
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
Description5-TAMRA-Amyloid β-Protein (1-40) is a fluorescently labeled peptide targeting the Amyloid β-Protein (1-40) with an excitation/emission wavelength of 544/572 nm. This reagent is designed for the study of amyloid aggregation, facilitating the investigation of Alzheimer's disease pathology. Its fluorescence properties make it suitable for applications in live-cell imaging and fluorescence microscopy, enabling researchers to track amyloid formation and accumulation in various biological contexts.
Product Information
Catalog NumA78348
FormulaC219H315N55O62S
Molecular Weight4742.24
CAS Number1802087-81-5
Sequence{5-TAMRA-Asp}-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Sequence shortening{5-TAMRA}-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2