Biological Activity
Amylin (rat) is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor. Sequence: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7);KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7).
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
0.1 mM | 2.55 mL | 12.75 mL | 25.51 mL |
0.5 mM | 0.51 mL | 2.55 mL | 5.1 mL |
1 mM | 0.26 mL | 1.28 mL | 2.55 mL |
5 mM | 0.05 mL | 0.26 mL | 0.51 mL |
*The above data is based on the productmolecular weight 3920.43. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Catalog Num | A16892 |
---|---|
M. Wt | 3920.43 |
Formula | C167H272N52O53S2 |
Solubility | DMSO |
Purity | >98% |
Storage | at -20°C 3 years Powder |
CAS No. | 124447-81-0 |
Synonyms | IAPP; Amylin, amide, rat |
SMILES | [H]N[[email protected]@H](CCCCN)C(=O)N[[email protected]]1CSSC[[email protected]](NC(=O)[[email protected]@H](NC(=O)[[email protected]](C)NC(=O)[[email protected]@H](NC(=O)[[email protected]](CC(N)=O)NC1=O)[[email protected]@H](C)O)[[email protected]@H](C)O)C(=O)N[[email protected]@H](C)C(=O)N[[email protected]@H]([[email protected]@H](C)O)C(=O)N[[email protected]@H](CCC(N)=O)C(=O)N[[email protected]@H](CCCNC(N)=N)C(=O)N[[email protected]@H](CC(C)C)C(=O)N[[email protected]@H](C)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](CC1=CC=CC=C1)C(=O)N[[email protected]@H](CC(C)C)C(=O)N[[email protected]@H](C(C)C)C(=O)N[[email protected]@H](CCCNC(N)=N)C(=O)N[[email protected]@H](CO)C(=O)N[[email protected]@H](CO)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](CC(C)C)C(=O)NCC(=O)N1CCC[[email protected]]1C(=O)N[[email protected]@H](C(C)C)C(=O)N[[email protected]@H](CC(C)C)C(=O)N1CCC[[email protected]]1C(=O)N1CCC[[email protected]]1C(=O)N[[email protected]@H]([[email protected]@H](C)O)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](C(C)C)C(=O)NCC(=O)N[[email protected]@H](CO)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H]([[email protected]@H](C)O)C(=O)N[[email protected]@H](CC1=CC=C(O)C=C1)C(N)=O |
Product Tags
Product Questions
Product Questions
No Questions
Keywords:buy Amylin (rat) | Amylin (rat) Supplier | purchase | cost | manufacturer | order | distributor | buy 124447-81-0| 124447-81-0 Supplier | purchase 124447-81-0 | 124447-81-0 cost | 124447-81-0 manufacturer | order 124447-81-0 | 124447-81-0 distributor