Amylin (rat)

Catalog No.: A16892

Amylin receptor ligand

Amylin (rat)

Amylin (rat) Chemical Structure

CAS NO. 124447-81-0

Amylin (rat) is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor. Sequence: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7);KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7).

Availability: In stock

Package Price Qty
0.5 mg

Regular Price: $180.00

Special Price $144.00

1 mg

Regular Price: $300.00

Special Price $240.00

2 mg

Regular Price: $560.00

Special Price $448.00

5 mg

Regular Price: $1,100.00

Special Price $880.00

Custom Size Get quote

Free Overnight Delivery on orders over $500

Next day delivery by 10:00 a.m. Order now.

Warning Products are for laboratory research use only. Not for human use. We do not sell to patients.

Biological Activity

Amylin (rat) is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor. Sequence: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7);KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7).
Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
0.1 mM 2.55 mL 12.75 mL 25.51 mL
0.5 mM 0.51 mL 2.55 mL 5.1 mL
1 mM 0.26 mL 1.28 mL 2.55 mL
5 mM 0.05 mL 0.26 mL 0.51 mL

*The above data is based on the productmolecular weight 3920.43. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Catalog Num A16892
CAS No. 124447-81-0
Formula C167H272N52O53S2
M. Wt 3920.43
Purity >98%
Synonyms IAPP; Amylin, amide, rat
SMILES [H]N[[email protected]@H](CCCCN)C(=O)N[[email protected]]1CSSC[[email protected]](NC(=O)[[email protected]@H](NC(=O)[[email protected]](C)NC(=O)[[email protected]@H](NC(=O)[[email protected]](CC(N)=O)NC1=O)[[email protected]@H](C)O)[[email protected]@H](C)O)C(=O)N[[email protected]@H](C)C(=O)N[[email protected]@H]([[email protected]@H](C)O)C(=O)N[[email protected]@H](CCC(N)=O)C(=O)N[[email protected]@H](CCCNC(N)=N)C(=O)N[[email protected]@H](CC(C)C)C(=O)N[[email protected]@H](C)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](CC1=CC=CC=C1)C(=O)N[[email protected]@H](CC(C)C)C(=O)N[[email protected]@H](C(C)C)C(=O)N[[email protected]@H](CCCNC(N)=N)C(=O)N[[email protected]@H](CO)C(=O)N[[email protected]@H](CO)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](CC(C)C)C(=O)NCC(=O)N1CCC[[email protected]]1C(=O)N[[email protected]@H](C(C)C)C(=O)N[[email protected]@H](CC(C)C)C(=O)N1CCC[[email protected]]1C(=O)N1CCC[[email protected]]1C(=O)N[[email protected]@H]([[email protected]@H](C)O)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H](C(C)C)C(=O)NCC(=O)N[[email protected]@H](CO)C(=O)N[[email protected]@H](CC(N)=O)C(=O)N[[email protected]@H]([[email protected]@H](C)O)C(=O)N[[email protected]@H](CC1=CC=C(O)C=C1)C(N)=O
Storage

Store lyophilized at -20ºC, keep desiccated.
In lyophilized form, the chemical is stable for 36 months.
In solution, store at -20ºC and use within 3 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Product Tags

Product Tags

Use spaces to separate tags. Use single quotes (') for phrases.

Product Questions

Product Questions

No Questions
Keywords:buy Amylin (rat) | Amylin (rat) Supplier | purchase | cost | manufacturer | order | distributor | buy 124447-81-0| 124447-81-0 Supplier | purchase 124447-81-0 | 124447-81-0 cost | 124447-81-0 manufacturer | order 124447-81-0 | 124447-81-0 distributor
Rewards