Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.
Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.
Product Information
Catalog Num
A22870
Formula
C147H238N44O42S.C2H4O2
Molecular Weight
3385.9
CAS Number
1444827-29-5
Sequence shortening
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Synonyms
Vasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine)
This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:
