Calcitonin (salmon)

Catalog No.: A17989
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
Grouped product items
Product Name Price Stock Qty
Calcitonin (salmon) 1mg
$106.00
In stock
Calcitonin (salmon) 5mg
$209.00
In stock
Calcitonin (salmon) 10mg
$285.00
In stock
Calcitonin (salmon) 25mg
$453.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
Product Information
Catalog Num A17989
Formula C145H240N44O48S2
Molecular Weight 3431.85
CAS Number 47931-85-1
Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Sequence shortening CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)
Synonyms Salmon calcitonin
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Calcitonin (salmon) | Calcitonin (salmon) Supplier | purchase Calcitonin (salmon) | Calcitonin (salmon) cost | Calcitonin (salmon) manufacturer | order Calcitonin (salmon) | Calcitonin (salmon) distributor | buy 47931-85-1 | 47931-85-1 Supplier | purchase 47931-85-1 | 47931-85-1 cost | 47931-85-1 manufacturer | order 47931-85-1 | 47931-85-1 distributor