Charybdotoxin

Catalog No.: A68059
Potassium Channel Inhibitor
Charybdotoxin is a 37-amino acid peptide that selectively inhibits potassium channels. Its primary mechanism involves blocking voltage-gated K+ channels, leading to altered neuronal excitability and muscle contraction. This compound is useful in research applications focused on neurophysiology, cardiac function, and ion channel studies, providing insights into the role of potassium channels in physiological and pathological processes.
Grouped product items
Size Price Stock Qty
100µg
$110.00
In stock
500µg
$250.00
In stock
1mg
$400.00
In stock
5mg
$1,025.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
DescriptionCharybdotoxin is a 37-amino acid peptide that selectively inhibits potassium channels. Its primary mechanism involves blocking voltage-gated K+ channels, leading to altered neuronal excitability and muscle contraction. This compound is useful in research applications focused on neurophysiology, cardiac function, and ion channel studies, providing insights into the role of potassium channels in physiological and pathological processes.
Product Information
Catalog NumA68059
FormulaC176H277N57O55S7
Molecular Weight4295.89
CAS Number95751-30-7
Sequence{Glp}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
Sequence shortening{Glp}-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2