(D-His1)-Exenatide

Catalog No.: A60500
GCGR Control
(D-His1)-Exenatide is a characterized impurity of Exenatide, which primarily targets the glucagon receptor (GCGR). This reagent is of interest for studies involving glucagon signaling pathways and metabolic regulation. Its use in research applications can help elucidate the role of glucagon in glucose homeostasis and diabetes-related pathologies.
Grouped product items
Size Stock
5mg
10mg
50mg
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
Description(D-His1)-Exenatide is a characterized impurity of Exenatide, which primarily targets the glucagon receptor (GCGR). This reagent is of interest for studies involving glucagon signaling pathways and metabolic regulation. Its use in research applications can help elucidate the role of glucagon in glucose homeostasis and diabetes-related pathologies.
Product Information
Catalog NumA60500
FormulaC184H282N50O60S
Molecular Weight4186.57
CAS Number1678417-09-8
Sequence{d-His}-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence shortening{d-His}-GEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2