DPro5 Corticotropin Releasing Factor, human, rat

Catalog No.: A59756
CRFR2 Agonist
[DPro5] Corticotropin Releasing Factor, human, rat is a selective agonist for the CRFR2 receptor, primarily involved in neuroendocrine response regulation. This molecule stimulates the release of adrenocorticotropic hormone (ACTH) and β-endorphin, contributing to various physiological responses. Notably, unlike traditional CRF peptides, [DPro5] does not induce anxiogenic effects, instead demonstrating potential to influence learning and memory processes in rat models. It serves as a valuable tool for investigating the role of CRFR2 in stress response and cognitive function.
Grouped product items
Size Stock
5mg
10mg
50mg
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
Description[DPro5] Corticotropin Releasing Factor, human, rat is a selective agonist for the CRFR2 receptor, primarily involved in neuroendocrine response regulation. This molecule stimulates the release of adrenocorticotropic hormone (ACTH) and β-endorphin, contributing to various physiological responses. Notably, unlike traditional CRF peptides, [DPro5] does not induce anxiogenic effects, instead demonstrating potential to influence learning and memory processes in rat models. It serves as a valuable tool for investigating the role of CRFR2 in stress response and cognitive function.
Product Information
Catalog NumA59756
FormulaC208H344N60O63S2
Molecular Weight4757.45
CAS Number195628-97-8
Sequence shorteningSEEP-{d-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2