Gastrin-Releasing Peptide, human

Name: Gastrin-Releasing Peptide, human
Brand: Adooq Bioscience
SKU: A22769
Rating: 5 (288 reviews)

Catalog No.: A22769

Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.

Skip to the end of the images gallery

Gastrin-Releasing Peptide, human 93755-85-2

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
500µg	$110.00	In stock
1mg	$150.00	In stock
5mg	$580.00	In stock
10mg	$790.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.

Product Information

Catalog Num	A22769
Formula	C130H204N38O31S2
Molecular Weight	2859.38
CAS Number	93755-85-2
Sequence	Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Sequence shortening	VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂