Gastrin-Releasing Peptide, human

Catalog No.: A22769
Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
Grouped product items
Product Name Price Stock Qty
Gastrin-Releasing Peptide, human 0.5mg
$115.00
In stock
Gastrin-Releasing Peptide, human 1mg
$155.00
In stock
Gastrin-Releasing Peptide, human 5mg
$587.00
In stock
Gastrin-Releasing Peptide, human 10mg
$795.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
Product Information
Catalog Num A22769
Formula C130H204N38O31S2
Molecular Weight 2859.38
CAS Number 93755-85-2
Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Sequence shortening VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Gastrin-Releasing Peptide, human | Gastrin-Releasing Peptide, human Supplier | purchase Gastrin-Releasing Peptide, human | Gastrin-Releasing Peptide, human cost | Gastrin-Releasing Peptide, human manufacturer | order Gastrin-Releasing Peptide, human | Gastrin-Releasing Peptide, human distributor | buy 93755-85-2 | 93755-85-2 Supplier | purchase 93755-85-2 | 93755-85-2 cost | 93755-85-2 manufacturer | order 93755-85-2 | 93755-85-2 distributor