GRF (1-29) amide (rat)

Catalog No.: A22846
GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.
Grouped product items
Product Name Price Stock Qty
GRF (1-29) amide (rat) 1mg
$122.00
In stock
GRF (1-29) amide (rat) 5mg
$240.00
In stock
GRF (1-29) amide (rat) 10mg
$342.00
In stock
GRF (1-29) amide (rat) 25mg
$770.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.
Product Information
Catalog Num A22846
Formula C155H251N49O40S
Molecular Weight 3473.08
CAS Number 91826-20-9
Sequence His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2
Sequence shortening HADAIFTSSYRRILGQLYARKLLHEIMNR-NH2
Synonyms rGHRH(1-29)NH2
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy GRF (1-29) amide (rat) | GRF (1-29) amide (rat) Supplier | purchase GRF (1-29) amide (rat) | GRF (1-29) amide (rat) cost | GRF (1-29) amide (rat) manufacturer | order GRF (1-29) amide (rat) | GRF (1-29) amide (rat) distributor | buy 91826-20-9 | 91826-20-9 Supplier | purchase 91826-20-9 | 91826-20-9 cost | 91826-20-9 manufacturer | order 91826-20-9 | 91826-20-9 distributor