Imapextide

Catalog No.: A60609
GLP-1 Antagonist
Imapextide is a glucagon-like peptide-1 (GLP-1) receptor antagonist that plays a critical role in the study of hypoglycemia. By inhibiting GLP-1 activity, Imapextide provides insights into glucose homeostasis and insulin secretion regulation. It is a valuable tool for researchers investigating metabolic disorders and the physiological effects of GLP-1 signaling.
Grouped product items
Size Price Stock Qty
5mg
$265.00
In stock
10mg
$435.00
In stock
25mg
$875.00
In stock
50mg
$1,365.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
DescriptionImapextide is a glucagon-like peptide-1 (GLP-1) receptor antagonist that plays a critical role in the study of hypoglycemia. By inhibiting GLP-1 activity, Imapextide provides insights into glucose homeostasis and insulin secretion regulation. It is a valuable tool for researchers investigating metabolic disorders and the physiological effects of GLP-1 signaling.
Product Information
Catalog NumA60609
FormulaC166H257N39O50
Molecular Weight3599.05
CAS Number3004569-93-8
Sequence{C18 diacid-Asp}-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Val-Arg-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
Sequence shortening{C18 diacid-Asp}-VSSYLEEQAVREFIAWLVRGGPSSGAPPPS
SynonymsMBX 1416
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2