Zovaglutide

Catalog No.: A60643
GLP-1 Receptor Agonist
Zovaglutide is a long-acting GLP-1 receptor agonist that enhances albumin binding capacity through dual fatty acid chain modification. It mediates metabolic effects via central and peripheral GLP-1 pathways, promoting satiety, reducing caloric intake, and enhancing glucose-dependent insulin secretion, without affecting GIP or glucagon receptors. This compound is well-suited for research applications related to type 2 diabetes and obesity.
Grouped product items
Size Stock
5mg
10mg
50mg
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
DescriptionZovaglutide is a long-acting GLP-1 receptor agonist that enhances albumin binding capacity through dual fatty acid chain modification. It mediates metabolic effects via central and peripheral GLP-1 pathways, promoting satiety, reducing caloric intake, and enhancing glucose-dependent insulin secretion, without affecting GIP or glucagon receptors. This compound is well-suited for research applications related to type 2 diabetes and obesity.
Product Information
Catalog NumA60643
FormulaC374H584N96O123
Molecular Weight8393.21
CAS Number3013543-64-8
SequenceHis-{Aib}Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Gly-Gly-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Ala-Gln-Pro-Gly-Gln-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-Pro
Sequence shorteningH-{Aib}-EGTFTSDVSSYLEEQAA-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-EFIAWLVRGGGGAQPGAQPGAQPGAQPGAQPGAQPGAQPGAQPGAQPGQ-{Lys(AEEA-AEEA-gGlu-C18 diacid)}-P
SynonymsZT002
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2