β-Endorphin (rat)

Name: β-Endorphin (rat)
Brand: Adooq Bioscience
SKU: A62459
Rating: 5 (288 reviews)

Catalog No.: A62459

Opioid Neuropeptide

β-Endorphin (rat) is an endogenous opioid neuropeptide that primarily targets opioid receptors, playing a key role in pain modulation. Its analgesic properties make it significant in studies related to pain management and the regulation of food intake in satiated states. This reagent is valuable for research investigating neurological disorders, including analgesia and drug addiction.

Skip to the end of the images gallery

β-Endorphin (rat) 309246-19-3 Opioid Neuropeptide

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
5mg	$350.00	In stock
10mg	$650.00	In stock
50mg	$2,000.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	β-Endorphin (rat) is an endogenous opioid neuropeptide that primarily targets opioid receptors, playing a key role in pain modulation. Its analgesic properties make it significant in studies related to pain management and the regulation of food intake in satiated states. This reagent is valuable for research investigating neurological disorders, including analgesia and drug addiction.

Product Information

Catalog Num	A62459
Formula	C157H254N42O44S
Molecular Weight	3466.02
CAS Number	309246-19-3
Sequence	Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln
Sequence shortening	YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ
SMILES	CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)[C@@H](C)O)C(C)C)[C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂