Exendin-4 Acetate

Catalog No.: A21378

glucagon-like peptide-1 receptor agonist

Exendin-4 Acetate

Exendin-4 Acetate Chemical Structure

CAS NO. 914454-01-6

Exendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.

Availability: In stock

Package Price Qty
5 mg
$151.00
10 mg
$260.00
50 mg
$773.00
100 mg
$1,546.00
Custom Size Get quote

Free Overnight Delivery on orders over $500

Next day delivery by 10:00 a.m. Order now.

Warning Products are for laboratory research use only. Not for human use. We do not sell to patients.

Biological Activity

Exendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
0.1 mM 2.35 mL 11.77 mL 23.55 mL
0.5 mM 0.47 mL 2.35 mL 4.71 mL
1 mM 0.24 mL 1.18 mL 2.35 mL
5 mM 0.05 mL 0.24 mL 0.47 mL

*The above data is based on the productmolecular weight 4246.62. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Catalog Num A21378
Actions Agonist
M. Wt 4246.62
Formula C186H286N50O62S
Solubility DMSO
Purity >98%
Storage at -20°C 3 years Powder
CAS No. 914454-01-6
Synonyms Exenatide acetate
SMILES CC(O)=O.[HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2]

Product Tags

Product Tags

Use spaces to separate tags. Use single quotes (') for phrases.

Product Questions

Product Questions

No Questions
Keywords:buy Exendin-4 Acetate | Exendin-4 Acetate Supplier | purchase | cost | manufacturer | order | distributor | buy 914454-01-6| 914454-01-6 Supplier | purchase 914454-01-6 | 914454-01-6 cost | 914454-01-6 manufacturer | order 914454-01-6 | 914454-01-6 distributor
Rewards