Biological Activity
Exendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
---|---|---|---|
0.1 mM | 2.35 mL | 11.77 mL | 23.55 mL |
0.5 mM | 0.47 mL | 2.35 mL | 4.71 mL |
1 mM | 0.24 mL | 1.18 mL | 2.35 mL |
5 mM | 0.05 mL | 0.24 mL | 0.47 mL |
*The above data is based on the productmolecular weight 4246.62. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
Catalog Num | A21378 |
---|---|
Actions | Agonist |
CAS No. | 914454-01-6 |
Formula | C186H286N50O62S |
M. Wt | 4246.62 |
Purity | >98% |
Synonyms | Exenatide acetate |
SMILES | CC(O)=O.[HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2] |
Storage | Store lyophilized at -20ºC, keep desiccated. |
Product Tags
Product Questions
Product Questions
No Questions
Keywords:buy Exendin-4 Acetate | Exendin-4 Acetate Supplier | purchase | cost | manufacturer | order | distributor | buy 914454-01-6| 914454-01-6 Supplier | purchase 914454-01-6 | 914454-01-6 cost | 914454-01-6 manufacturer | order 914454-01-6 | 914454-01-6 distributor