Exendin-4 Acetate

Catalog No.: A21378
glucagon-like peptide-1 receptor agonist
Exendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
Grouped product items
Size Price Stock Qty
1mg
$55.00
In stock
5mg
$135.00
In stock
10mg
$200.00
In stock
25mg
$290.00
In stock
50mg
$435.00
In stock
100mg
$645.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Other Forms of Exendin-4 Acetate

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
DescriptionExendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
Product Information
Catalog NumA21378
FormulaC186H286N50O62S
Molecular Weight4246.62
CAS Number914454-01-6
SMILESCC(O)=O.[HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2]
SynonymsExenatide acetate
Storage

Store lyophilized at -20ºC, keep desiccated.
In lyophilized form, the chemical is stable for 36 months.
In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2