Exendin-4 Acetate

Catalog No.: A21378
glucagon-like peptide-1 receptor agonist
Exendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
Grouped product items
Product Name Price Stock Qty
Exendin-4 Acetate 5mg
Special Price $120.80 Regular Price $151.00
In stock
Exendin-4 Acetate 10mg
Special Price $208.00 Regular Price $260.00
In stock
Exendin-4 Acetate 50mg
Special Price $618.40 Regular Price $773.00
In stock
Exendin-4 Acetate 100mg
Special Price $1,236.80 Regular Price $1,546.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Other Forms of Exendin-4 Acetate

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Exendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
Product Information
Catalog Num A21378
Formula C186H286N50O62S
Molecular Weight 4246.62
CAS Number 914454-01-6
SMILES CC(O)=O.[HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2]
Synonyms Exenatide acetate
Storage

Store lyophilized at -20ºC, keep desiccated.
In lyophilized form, the chemical is stable for 36 months.
In solution, store at -20ºC and use within 3 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Exendin-4 Acetate | Exendin-4 Acetate Supplier | purchase Exendin-4 Acetate | Exendin-4 Acetate cost | Exendin-4 Acetate manufacturer | order Exendin-4 Acetate | Exendin-4 Acetate distributor | buy 914454-01-6 | 914454-01-6 Supplier | purchase 914454-01-6 | 914454-01-6 cost | 914454-01-6 manufacturer | order 914454-01-6 | 914454-01-6 distributor