Exendin-4 Acetate
Important Notice: For research use only. We do not sell to patients.
Other Forms of Exendin-4 Acetate
Not your Region? View all Distributors
Important Notice: For research use only. We do not sell to patients.
Not your Region? View all Distributors
Discription | Exendin-4 Acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM. |
---|
Catalog Num | A21378 |
---|---|
Formula | C186H286N50O62S |
Molecular Weight | 4246.62 |
CAS Number | 914454-01-6 |
SMILES | CC(O)=O.[HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2] |
Synonyms | Exenatide acetate |
Storage | Store lyophilized at -20ºC, keep desiccated. |
Calculate the dilution required to prepare a stock solution. This equation is commonly abbreviated as: C1V1 = C2V2