Exendin(9-39) amide

Catalog No.: A22078
Avexitide (Exendin (9-39)) is a specific and competitive GLP-1 receptor antagonist.
Grouped product items
Product Name Price Stock Qty
Exendin(9-39) amide 0.5mg
$168.00
In stock
Exendin(9-39) amide 1mg
$307.00
In stock
Exendin(9-39) amide 5mg
$521.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Avexitide (Exendin (9-39)) is a specific and competitive GLP-1 receptor antagonist.
Product Information
Catalog Num A22078
Formula C149H234N40O47S
Molecular Weight 3369.76
CAS Number 133514-43-9
Sequence Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Sequence shortening DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Synonyms Avexitide
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Exendin(9-39) amide | Exendin(9-39) amide Supplier | purchase Exendin(9-39) amide | Exendin(9-39) amide cost | Exendin(9-39) amide manufacturer | order Exendin(9-39) amide | Exendin(9-39) amide distributor | buy 133514-43-9 | 133514-43-9 Supplier | purchase 133514-43-9 | 133514-43-9 cost | 133514-43-9 manufacturer | order 133514-43-9 | 133514-43-9 distributor