Gastric Inhibitory Peptide, porcine

Name: Gastric Inhibitory Peptide, porcine
Brand: Adooq Bioscience
SKU: A22996
Rating: 5 (288 reviews)

Catalog No.: A22996

Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.

Skip to the end of the images gallery

Gastric Inhibitory Peptide, porcine 11063-17-5

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
1mg	$75.00	In stock
5mg	$245.00	In stock
10mg	$375.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.

Product Information

Catalog Num	A22996
Formula	C225H342N60O66S
Molecular Weight	4975.55
CAS Number	11063-17-5
Sequence shortening	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Synonyms	GIP (1-42), porcine
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂