Gastric Inhibitory Peptide, porcine

Catalog No.: A22996
Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.
Grouped product items
Product Name Price Stock Qty
Gastric Inhibitory Peptide, porcine 1mg
$80.00
In stock
Gastric Inhibitory Peptide, porcine 5mg
$250.00
In stock
Gastric Inhibitory Peptide, porcine 10mg
$384.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.
Product Information
Catalog Num A22996
Formula C225H342N60O66S
Molecular Weight 4975.55
CAS Number 11063-17-5
Sequence shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Synonyms GIP (1-42), porcine
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Gastric Inhibitory Peptide, porcine | Gastric Inhibitory Peptide, porcine Supplier | purchase Gastric Inhibitory Peptide, porcine | Gastric Inhibitory Peptide, porcine cost | Gastric Inhibitory Peptide, porcine manufacturer | order Gastric Inhibitory Peptide, porcine | Gastric Inhibitory Peptide, porcine distributor | buy 11063-17-5 | 11063-17-5 Supplier | purchase 11063-17-5 | 11063-17-5 cost | 11063-17-5 manufacturer | order 11063-17-5 | 11063-17-5 distributor