GLP-1(7-36), amide acetate

Catalog No.: A22562
GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
Grouped product items
Product Name Price Stock Qty
GLP-1(7-36), amide acetate 0.5mg
$125.00
In stock
GLP-1(7-36), amide acetate 1mg
$227.00
In stock
GLP-1(7-36), amide acetate 5mg
$622.00
In stock
GLP-1(7-36), amide acetate 10mg
$958.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
Product Information
Catalog Num A22562
Formula C149H226N40O45.xC2H4O2
Molecular Weight 3297.64 (free base)
CAS Number 1119517-19-9
Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Sequence shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2
Synonyms Glucagon-like peptide-1 (GLP-1(7-36, amide acetate; Human GLP-1 (7-36, amide acetate
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy GLP-1(7-36), amide acetate | GLP-1(7-36), amide acetate Supplier | purchase GLP-1(7-36), amide acetate | GLP-1(7-36), amide acetate cost | GLP-1(7-36), amide acetate manufacturer | order GLP-1(7-36), amide acetate | GLP-1(7-36), amide acetate distributor | buy 1119517-19-9 | 1119517-19-9 Supplier | purchase 1119517-19-9 | 1119517-19-9 cost | 1119517-19-9 manufacturer | order 1119517-19-9 | 1119517-19-9 distributor