Lixisenatide acetate

Name: Lixisenatide acetate
Brand: Adooq Bioscience
SKU: A22791
Rating: 5 (288 reviews)

Catalog No.: A22791

GLP-1 agonist

Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).

Skip to the end of the images gallery

Lixisenatide acetate 1997361-87-1 <p>GLP-1 agonist</p>

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
1mg	$50.00	In stock
5mg	$110.00	In stock
10mg	$185.00	In stock
25mg	$315.00	In stock
50mg	$455.00	In stock
100mg	$625.00	In stock
200mg	$840.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).

Product Information

Catalog Num	A22791
Formula	C215H347N61O65S.6C2H4O2
Molecular Weight	5218.79
CAS Number	1997361-87-1
Sequence shortening	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂