Lixisenatide acetate

Catalog No.: A22791

GLP-1 agonist

Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
Grouped product items
Product Name Price Stock Qty
Lixisenatide acetate 1mg
$112.00
In stock
Lixisenatide acetate 5mg
$202.00
In stock
Lixisenatide acetate 10mg
$342.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
Product Information
Catalog Num A22791
Formula C215H347N61O65S.6C2H4O2
Molecular Weight 5218.79
CAS Number 1997361-87-1
Sequence shortening HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Lixisenatide acetate | Lixisenatide acetate Supplier | purchase Lixisenatide acetate | Lixisenatide acetate cost | Lixisenatide acetate manufacturer | order Lixisenatide acetate | Lixisenatide acetate distributor | buy 1997361-87-1 | 1997361-87-1 Supplier | purchase 1997361-87-1 | 1997361-87-1 cost | 1997361-87-1 manufacturer | order 1997361-87-1 | 1997361-87-1 distributor