Oxyntomodulin (bovine, porcine)

Catalog No.: A22766

GLP-1 receptor agonist

Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist.
Grouped product items
Product Name Price Stock Qty
Oxyntomodulin (bovine, porcine) 1mg
$190.00
In stock
Oxyntomodulin (bovine, porcine) 5mg
$525.00
In stock
Oxyntomodulin (bovine, porcine) 10mg
$774.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist.
Product Information
Catalog Num A22766
Formula C192H295N59O60S
Molecular Weight 4421.86
CAS Number 62340-29-8
Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala
Sequence shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Synonyms Glucagon-37 (bovine, porcine
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Oxyntomodulin (bovine, porcine) | Oxyntomodulin (bovine, porcine) Supplier | purchase Oxyntomodulin (bovine, porcine) | Oxyntomodulin (bovine, porcine) cost | Oxyntomodulin (bovine, porcine) manufacturer | order Oxyntomodulin (bovine, porcine) | Oxyntomodulin (bovine, porcine) distributor | buy 62340-29-8 | 62340-29-8 Supplier | purchase 62340-29-8 | 62340-29-8 cost | 62340-29-8 manufacturer | order 62340-29-8 | 62340-29-8 distributor