PMAP-36

Catalog No.: A48493
Antimicrobial Peptide
PMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease.
Grouped product items
Size Price Stock Qty
1mg
$175.00
In stock
5mg
$450.00
In stock
10mg
$645.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Biological Activity
DescriptionPMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease.
Product Information
Catalog NumA48493
FormulaC191H336N62O39S
Molecular Weight4157.17
CAS Number154338-08-6
SequenceGly-Arg-Phe-Arg-Arg-Leu-Arg-Lys-Lys-Thr-Arg-Lys-Arg-Leu-Lys-Lys-Ile-Gly-Lys-Val-Leu-Lys-Trp-Ile-Pro-Pro-Ile-Val-Gly-Ser-Ile-Pro-Leu-Gly-Cys-Gly
Sequence shorteningGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
SynonymsPorcine cathelicidin PMAP-36
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2