PMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease.
PMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease.
This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:
