VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide designed to mimic the C-terminal domain of the α2δ-1 protein, also referred to as the α2δ-1Tat peptide. This peptide is capable of effectively disrupting the interaction between α2δ-1 and N-methyl-D-aspartate receptors (NMDARs) both in vitro and in vivo. It is a valuable tool for research into the mechanisms underlying neuropathic pain, aiding in the exploration of targeted therapeutic interventions.
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide designed to mimic the C-terminal domain of the α2δ-1 protein, also referred to as the α2δ-1Tat peptide. This peptide is capable of effectively disrupting the interaction between α2δ-1 and N-methyl-D-aspartate receptors (NMDARs) both in vitro and in vivo. It is a valuable tool for research into the mechanisms underlying neuropathic pain, aiding in the exploration of targeted therapeutic interventions.
This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula: