Amyloid b-Peptide (1-40) (human)

Name: Amyloid b-Peptide (1-40) (human)
Brand: Adooq Bioscience
SKU: A15418
Rating: 5 (288 reviews)

Catalog No.: A15418

Amyloid b-Peptide (1-40) (human) is a peptide processed from the amyloid precursor protein (APP).

Skip to the end of the images gallery

Amyloid b-Peptide (1-40) (human) 131438-79-4

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
500µg	$120.00	In stock
1mg	$220.00	In stock
5mg	$650.00	In stock
10mg	$1,080.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Amyloid b-Peptide (1-40) (human) related products

alpha-Amyloid Precursor Protein Modulator

Amyloid b-Peptide (1-42) (human)

Amyloid b-peptide (42-1) (human)

Amyloid b-Peptide (10-20) (human)

Amyloid b-peptide (25-35) (human)

Amyloid b-Peptide (12-28) (human)

Amyloid b-peptide (1-40) (rat)

Amyloid b-peptide (1-42) (rat)

Amyloid b-Peptide (1-43) (human)

beta-Amyloid (1-11)

Amyloid b-Protein (1-15)

amyloid P-IN-1

β-Amyloid (35-42)

β-Amyloid peptide(16-20)

Acetly-β Amyloid(15-20), Amide

Biological Activity

Description

Amyloid b-Peptide (1-40) (human) is a peptide processed from the amyloid precursor protein (APP).

References

Cleary et al (1995) Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 682 69 PMID: 7552329

Kowalska and Badellino (1994) β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Commun. 205 1829 PMID: 7811271

Miguel-Hidalgo and Cacabelos (1998) Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 95 455 PMID: 9600591

Yankner et al (1990) Neurotrophic and neurotoxic effects of amyloid β protein: reversal by tachykinin neuropeptides. Science 250 279 PMID: 2218531

Product Information

Catalog Num	A15418
Formula	C194H295N53O58S
Molecular Weight	4329.86
CAS Number	131438-79-4
Sequence	Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Sequence shortening	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
SMILES	[H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O
Synonyms	Amyloid beta peptide(1-40) (synthetic), Abeta(1-40), Abeta40, Human beta-amyloid peptide-(1-40), beta-Amyloid peptide(1-40)
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂