Amyloid b-Peptide (1-42) (human)

Amyloid beta (Aβ or Abeta) is a peptide of 36-C43 amino acids that is processed from the Amyloid precursor protein. Amyloid β-Peptide (1-42) human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. Downregulates bcl-2 and increases the levels of bax. Neurotoxic.

Grouped product items
Size Price Stock Qty
1mg
$150.00
In stock
5mg
$350.00
In stock
10mg
$600.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Adooq's Amyloid b-Peptide (1-42) (human) has been cited by 11 publications
  • Kailash Jangid, .et al. , RSC Medicinal Chemistry, 2025, Sep 17
  • Kailash Jangid, .et al. , Comput Biol Med, 2025, Sep;196(Pt A):110762 PMID: 40664126
  • Nilufer Ercin, .et al. , Mol Neurobiol, 2025, Sep;62(9):11030-11046 PMID: 40257688
  • Naveen Kumar, .et al. , RSC Med Chem, 2024, Sep 24 PMID: 39399311
  • Naveen Kumar, .et al. , ACS Chem Neurosci, 2024, May 25
  • Yinhua Ni, .et al. , J Agric Food Chem, 2024, Jul 31;72(30):16708-16725 PMID: 39016108
  • Seda Onder, .et al. , Chem Biol Interact, 2022, Aug 25;363:110029 PMID: 35779611
  • Seham S El-Hawary, .et al. , Food Funct, 2022, Sep 7;12(17):8078-8089 PMID: 34286787
  • Zsolt Datki, .et al. , Int J Biol Macromol, 2022, Jan 7;201:262-269 PMID: 34999044
  • Suresh K.Bowroju, .et al. , Bioorg Med Chem, 2021, 45:116311
  • Zsolt Datki, .et al. , Ecotoxicol Environ Saf, 2021, Jan 15;208:111666 PMID: 33396176
Biological Activity
Description

Amyloid beta (Aβ or Abeta) is a peptide of 36-C43 amino acids that is processed from the Amyloid precursor protein. Amyloid β-Peptide (1-42) human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. Downregulates bcl-2 and increases the levels of bax. Neurotoxic.

In Vitro

Recommends the following protocol for re-suspending 100 µg of peptide into a 1 mg/mL solution:

  • 1. Bring dried peptide to room temperature for 10 minutes.
  • 2. Add 7.5 µL cold filter sterilized 1% Ammonium hydroxide (NH4OH) to the peptide aliquot, mix well by pipetting up and down. Take care to scrape inside lower walls of tube to ensure complete re-suspension of the film.
  • 3. Add 92.5 µL of cold filter sterilized PBS. Optional - Centrifuge monomer 14,000 x g at 4 C for approximately 5-10 minutes and keep the supernatant to remove any material that was not fully re-suspended.
  • 4. Keep monomer on ice and use immediately.

    * While it is not recommended, depending on your application small aliquots (≤ 50 μL) can be frozen and kept for up to 2 weeks at -80°C. However, aggregate should be removed by centrifugation at 4oC upon thawing.
References

Glenner and Wong (1984) Alzheimer's disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein. Biochem.Biophys.Res.Commun. 120 885 PMID: 6375662

Paradis et al (1996) Amyloid beta peptide of Alzheimer's disease downregulates bcl-2 and upregulates bax expression in human neurons. J.Neurosci. 16 7533 PMID: 8922409

Van Nostrand et al (1996) Amyloid β-protein induces the cerebrovascular cellular pathology of Alzheimer's disease and related disorders. Ann.N.Y.Acad.Sci. 777 297 PMID: 8624102

Product Information
Catalog NumA14075
FormulaC203H311N55O60S
Molecular Weight4514.08
CAS Number107761-42-2
Sequence

Asp-Ala-Glu-Phe-{Cit}-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Sequence shorteningDAEF-{Cit}-HDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
SMILES[H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O
Storage

Store lyophilized at -20ºC, keep desiccated.
In lyophilized form, the chemical is stable for 36 months.
In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2