Amyloid b-Peptide (1-40) (human)

Name: Amyloid b-Peptide (1-40) (human)
SKU: A15418
Price: 102 USD
Rating: 5 (288 reviews)

Catalog No.: A15418

Amyloid b-Peptide (1-40) (human) is a peptide processed from the amyloid precursor protein (APP).

Skip to the end of the images gallery

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
1mg	$102.00	In stock
5mg	$306.00	In stock
10mg	$510.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Data Sheet

SDS

Loading distributor info...

Adooq Products cited in reputable paper

Amyloid b-Peptide (1-40) (human) related products

alpha-Amyloid Precursor Protein Modulator

Amyloid b-Peptide (1-42) (human)

Amyloid b-peptide (42-1) (human)

Amyloid b-Peptide (10-20) (human)

Amyloid b-peptide (25-35) (human)

Amyloid b-Peptide (12-28) (human)

Amyloid b-peptide (1-40) (rat)

Amyloid b-peptide (1-42) (rat)

Amyloid b-Peptide (1-43) (human)

beta-Amyloid (1-11)

Amyloid b-Protein (1-15)

amyloid P-IN-1

β-Amyloid (35-42)

β-Amyloid peptide(16-20)

Acetly-β Amyloid(15-20), Amide

Biological Activity

Discription

Amyloid b-Peptide (1-40) (human) is a peptide processed from the amyloid precursor protein (APP).

References

Cleary et al (1995) Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 682 69 PMID: 7552329

Kowalska and Badellino (1994) β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Commun. 205 1829 PMID: 7811271

Miguel-Hidalgo and Cacabelos (1998) Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 95 455 PMID: 9600591

Yankner et al (1990) Neurotrophic and neurotoxic effects of amyloid β protein: reversal by tachykinin neuropeptides. Science 250 279 PMID: 2218531

Product Information

Catalog Num	A15418
Formula	C194H295N53O58S
Molecular Weight	4329.86
CAS Number	131438-79-4
Sequence	Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Sequence shortening	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
SMILES	[H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O
Synonyms	Amyloid beta peptide(1-40) (synthetic), Abeta(1-40), Abeta40, Human beta-amyloid peptide-(1-40), beta-Amyloid peptide(1-40)
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 3 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

Calculate Reset

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂