Catalog No.
Product Name
Application
Product Information
Citations
-
Precursor Peptide
TRH Precursor Peptide is a precursor peptide for thyrotropin-releasing hormone (TRH), functioning primarily through its role in the production of TRH in the rat brain and pituitary. The synthesis of TRH from this precursor is zinc-dependent, highlighting its significance in neuroendocrine regulation. This peptide is valuable for research in neurological studies and the assessment of thyroid function. -
Endogenous Bioactive Peptide
Salusin-α is an endogenous bioactive peptide that modulates hemodynamic responses and promotes cell proliferation. It effectively stimulates the proliferation of quiescent vascular smooth muscle cells (VSMCs) and fibroblasts, resulting in a notable decrease in blood pressure and heart rate. Although its effects are less potent than those of Salusin-β, Salusin-α holds significant potential for applications in cardiovascular disease research and therapeutic exploration. -
Neuropeptide
APGW-amide is a neuropeptide that primarily targets neuronal signaling pathways. It has been shown to control the growth of imposex structures and promote growth in Haliotis asinina. In studies, APGW-amide inhibits Achatina neurons and modulates neuronal currents affected by neuroactive compounds. Additionally, it induces a rapid increase in intracellular calcium levels in Fura-2/AM-loaded PC12 cells, making APGW-amide valuable for research focused on the nervous system. -
Activation Peptide
Enterostatin (rat) is an activation peptide of procolipase that plays a significant role in modulating fat intake. This peptide selectively reduces body fat consumption and lowers serum cholesterol levels through a cholecystokinin 1 (CCK1) receptor-dependent mechanism. It serves as a valuable tool for research on energy balance, appetite regulation, and metabolic disorders. -
Dipeptide
L-Arginyl-L-alanine is a dipeptide that serves as a vascular smooth muscle-derived relaxing factor. It enhances the levels of cyclic GMP and nitrite in denuded arterial rings, contributing to smooth muscle relaxation. This compound is of interest in research applications related to vascular biology and cardiovascular disease mechanisms. -
Neuropeptide
Prokineticin 2 Isoform 2 (human) is a neuropeptide primarily involved in the regulation of energy metabolism and thermoregulation. This compound has been shown to decrease food intake in rodent models, making it relevant for research into hyperglycemia, metabolic syndrome, and obesity. Its role in influencing metabolic pathways makes it a valuable reagent for studies focused on appetite regulation and energy balance. -
Insect Neuropeptide
Leucomyosuppressin is an insect neuropeptide that acts as an inhibitory myotropic peptide. It is known to inhibit evoked transmitter release at the mealworm neuromuscular junction, making it a valuable tool for studying neuromuscular transmission and neuropeptide signaling in insects. This compound can be utilized in research applications focused on insect physiology and neurobiology. -
Myoactive Neuropeptide
NGFFFamide is a myoactive neuropeptide identified in sea urchins. This compound is known to regulate muscle activity by binding directly to receptor proteins on muscle cells or indirectly by stimulating nerve endings to release muscle-active factors. NGFFFamide serves as a valuable tool for investigating mechanisms of muscle contraction and relaxation in various biological and pharmacological studies. -
Tetrapeptide
Antiulcer Agent 2 is a tetrapeptide comprised of aspartic acid, alanine, histidine, and lysine, known for its potential role in ulcer treatment. This compound is located at the N-terminal of human albumin, suggesting its involvement in physiological processes related to ulcer healing. Its biological activity may extend to modulating active oxygen species, making it a valuable reagent for research in gastroenterology and oxidative stress studies. -
Peptidoglycan pentapeptide
Ala-D-γ-Glu-Lys-D-Ala-D-Ala TFA is a synthetic peptidoglycan pentapeptide that serves as a crucial component of bacterial cell wall biosynthesis. This compound mimics the pentapeptide tail of the peptidoglycan precursor UDP-MurNAc-l-Ala-γ-d-Glu-l-Lys(Gly)(5)-d-Ala-d-Ala. It is primarily used in research focusing on antibiotic development and studies of bacterial growth, cell wall integrity, and resistance mechanisms. This reagent is essential for examining the biochemical pathways involved in peptidoglycan synthesis and the structural analysis of bacterial cell walls. -
Dipeptide
H-Val-Tyr-OH is a dipeptide composed of valine and tyrosine linked by a peptide bond. It has been identified as a potential inhibitor of IKKα, making it valuable for studying cancer and inflammatory diseases. This compound can aid in elucidating the role of IKKα in various biological processes and could contribute to the development of therapeutic strategies targeting related pathways. -
Glioblastoma-Targeting Nonapeptide
CooP is a linear glioblastoma-targeting nonapeptide that specifically binds to the mammary-derived growth inhibitor/fatty acid binding protein 3 (FABP3) found in glioblastoma cells and their associated vasculature. This peptide facilitates the targeted delivery of chemotherapy agents and various nanoparticles, enhancing therapeutic efficacy while minimizing off-target effects. Its application in glioblastoma research provides insights into novel treatment strategies for this challenging cancer type. -
Anticoagulant Peptide
E-76 is an anticoagulant peptide that specifically inhibits blood coagulation by binding to exogenous coagulation factor VIIa (FVIIa). This interaction disrupts the coagulation cascade, making E-76 a valuable tool for studying blood coagulation disorders and related pathophysiological conditions. Its application extends to research focused on thrombotic diseases and therapeutics targeting coagulation pathways. -
Fluorescent Peptide
Boc-Ile-Glu-Gly-Arg-AMC is a fluorogenic peptide substrate specifically designed for the activated factor X (FXa). This compound exhibits key biological activity by enabling the quantification of FXa in various biological assays. It is particularly useful in research applications focused on coagulation, thrombin generation, and related hemostatic studies. -
Chromogenic Peptide Substrate
Bz-Pro-Phe-Arg-pNA hydrochloride is a chromogenic peptide substrate specifically designed for the detection of plasma and glandular Kallikrein, cysteine proteinase (Cruzipain), and Trypsin. This compound exhibits significant biological activity as it enables the quantification of enzymatic activities in various assays, including the Factor XII assay. Its application in enzymology provides valuable insights into proteolytic processes and enzyme kinetics. -
GluR6/PSD-95 Inhibitor
PDZ1 Domain Inhibitor Peptide is a cyclic peptide designed to specifically target the PDZ1 domains of postsynaptic density protein 95 (PSD-95). By disrupting the interaction between GluR6 and PSD-95, this inhibitor effectively competes with the C terminus of GluR6 for binding to the PDZ1 domain. Its unique β-Ala lactam side chain linker enhances its efficacy in studies related to synaptic signaling and glutamate receptor regulation. This reagent is ideal for research applications focusing on neuronal communication and synaptic plasticity. -
Peptide
YHIEPV (rALP-2, Rubisco anxiolytic-like peptide 2) is an orally active peptide that targets the central nervous system to exhibit anxiolytic effects. This peptide enhances leptin sensitivity, contributing to its anti-obesity activity. YHIEPV is useful in research focused on anxiety modulation and metabolic regulation. -
NMDA Antagonist Peptide
Conantokin-T is a γ-carboxyglutamate-containing peptide that acts as an NMDA receptor antagonist, exhibiting an IC50 value of 2 μM. This compound inhibits NMDA receptor-mediated calcium influx in central nervous system neurons, making it a valuable tool for studying synaptic transmission and neurotoxicity. Derived from the venom of the fish-hunting cone snail, Conus tulipa, Conantokin-T is useful in research applications related to neuropharmacology and neurological disorders. -
Peptide Inhibitor
p-fin4 is a peptide inhibitor targeting the interaction between STEP phosphatase and the GluA2 subunit of the AMPA receptor, with a Ki of 0.4 μM. This compound has demonstrated the ability to restore memory deficits and exhibits anxiolytic and antidepressant effects in a scopolamine-induced rat model. p-fin4 represents a potential lead for the development of innovative cognitive enhancers and behavioral modulators, highlighting its significance in neurological research. -
Pep2-SVKI Control Peptide
Pep2-SVKE is an inactive control peptide designed for use with Pep2-SVKI. This peptide corresponds to the last ten amino acids of the C-terminus of the GluR2 AMPA receptor subunit, and does not inhibit AMPA-mediated [3H]DA exocytosis. Moreover, Pep2-SVKE does not interact with GRIP or PICK43, nor does it interfere with the retention of PICK1 by GST-GluR2 in long-term depression (LTD) studies. It is an essential tool for researchers evaluating the specific effects of Pep2-SVKI in their experiments. -
Excitatory Peptide
N-Acetylglycyl-D-glutamic acid is an excitatory peptide that acts on the central nervous system by inducing seizures in murine models. This compound serves as a valuable tool for studying seizure mechanisms and the role of excitatory neurotransmission in neurobiology. Its application in research aids in understanding the pathophysiology of epilepsy and related disorders. -
Pep2m Control Peptide
Pep4c is an inactive control peptide designed to serve as a negative counterpart to Pep2m, which specifically disrupts interactions between Protein Interacting with C Kinase 1 (PICK1) and AMPA receptor subunit GluA2, as well as N-ethylmaleimide-sensitive factor (NSF) and GluA2. This control peptide lacks the capacity to affect AMPA receptor trafficking and synaptic plasticity, making it suitable for validating the specificity of experimental results involving Pep2m. Researchers utilize Pep4c to ensure the accuracy of their findings in studies related to these key protein interactions. -
Bioactive Peptide
GluR23Y is a bioactive peptide targeting AMPA receptors. It has demonstrated the ability to inhibit insulin-mediated endocytosis of native AMPA receptors in cultured hippocampal neurons, as evidenced by its use in ELISA cell-surface assays. By preventing the insulin-induced reduction in receptor availability, GluR23Y serves as a valuable tool for research on synaptic plasticity and insulin signaling pathways in neural contexts. -
α2δ-1 C Terminus Mimicking Peptide
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide designed to mimic the C-terminal domain of the α2δ-1 protein, also referred to as the α2δ-1Tat peptide. This peptide is capable of effectively disrupting the interaction between α2δ-1 and N-methyl-D-aspartate receptors (NMDARs) both in vitro and in vivo. It is a valuable tool for research into the mechanisms underlying neuropathic pain, aiding in the exploration of targeted therapeutic interventions. -
Na+/K+ ATPase Inhibitor
Transdermal Peptide Disulfide is a synthetic 11-amino acid peptide that serves as an inhibitor of the Na+/K+-ATPase by binding to the beta-subunit (ATP1B1) and specifically interacting with its C-terminus. This compound enhances the transdermal delivery of various macromolecules, making it a valuable tool in drug formulation and transdermal research applications. Its ability to facilitate the transport of biologically relevant molecules may have significant implications for improving therapeutic delivery in clinical settings. -
Synthetic Peptide
AChRα(97-116) is a synthetic peptide derived from the 97-116 sequence of the rat acetylcholine receptor α-subunit, serving as an important tool for research involving autoimmune diseases, particularly experimental autoimmune myasthenia gravis. This peptide is instrumental in elucidating the mechanisms of autoimmunity and the pathophysiology of neuromuscular junction disorders. Its application in research may provide insights into therapeutic targets and disease progression. -
Pleiotropic Peptide
Catestatin (human) is a pleiotropic peptide that acts as a catecholamine release-inhibitory peptide. It exhibits key biological activities, including antihypertensive effects and angiogenesis promotion, thereby contributing to cardiovascular protection. This reagent is valuable for researching inflammatory diseases and other conditions associated with dysregulated catecholamine levels. -
nAChRs antagonist
Pentapeptide-3 is a pentapeptide derived from the neurotoxin waglerin-1, sourced from Temple Viper venom. It functions as a competitive antagonist of nicotinic acetylcholine receptors (nAChRs), effectively blocking nerve transmission at the post-synaptic membrane. Due to its ability to inhibit nAChRs, Pentapeptide-3 exhibits potential anti-aging effects and is often utilized in conjunction with other cosmetic peptides for research applications related to skin rejuvenation. -
Peptide
[D-Trp7,9,10]-Substance P is an analogue of substance P, primarily targeting substance P receptors. It exhibits the dual activity of stimulating these receptors while simultaneously inhibiting ion conductance through nicotinic acetylcholine receptors. This compound is useful in research applications focused on neuropeptide signaling and the modulation of pain pathways. Its unique pharmacological profile makes it a valuable tool for investigating receptor interactions and their downstream effects in various biological systems. -
Calmodulin Ligand
Calmodulin Binding Peptide 1 is a high-affinity ligand for calmodulin (CaM), originating from smooth muscle myosin light chain kinase. This peptide exhibits pM binding affinity and specifically interacts with Ca2+-bound calmodulin, facilitating the study of smooth muscle contraction mechanisms. It serves as an important tool for research applications aimed at selectively regulating calmodulin activity and developing therapeutic agents targeting calmodulin-related pathways. -
CaM kinase II Polypeptide
Calmodulin-Dependent Protein Kinase II (281-309) is a peptide corresponding to the regulatory domain of calcium/calmodulin-dependent protein kinase II (CaM-kinase II). This peptide plays a critical role in the regulation of various physiological processes, including synaptic plasticity and memory formation. It is utilized in research applications involving calcium signaling pathways, protein phosphorylation, and the study of neuronal function. -
CaM Binding Peptide
MLCK Peptide is a high-affinity (pM) calcium/calmodulin (CaM)-binding peptide derived from smooth muscle myosin light-chain kinase. This peptide serves as a valuable tool for studying CaM-mediated signaling pathways and muscle contraction mechanisms. Its reversible binding properties make it suitable for various applications in biochemical and physiological research, particularly in investigations of calcium signaling and muscle physiology. -
Peptide Ligand for GABARAP
K1 peptide is a high-affinity ligand for GABAA receptor-associated protein (GABARAP). It plays a crucial role in mediating protein interactions involved in cellular processes such as autophagy and synaptic transmission. K1 peptide is valuable for research applications focused on GABARAP function and its implications in neurobiology and cellular signaling pathways. -
Peptide
Octadecaneuropeptide is an 18-residue peptide that functions as a ligand for the gamma-aminobutyric acid (GABA) receptor's regulatory site, which is modulated by beta-carbolines. This peptide demonstrates significant biological activity by facilitating the punishment-induced suppression of drinking behavior in a dose-dependent manner. It serves as a valuable research tool for investigating GABAergic transmission and its implications in behavioral studies and neuropharmacology. -
Peptide Fragment
Leptin (22-56), human is a peptide fragment that plays a critical role in energy homeostasis and appetite regulation, interacting with various isoforms of leptin receptors (Ob-Rs). This fragment can be utilized in research applications focused on obesity, metabolic disorders, and endocrine signaling pathways. Its ability to influence signaling contributes to the understanding of leptin’s physiological effects and therapeutic potential in weight-related conditions. -
NCED3 Inducer
CLE25 peptide functions as an inducer of NCED3, facilitating the transport from roots to leaves and modulating NCED3 expression in conjunction with receptor-like kinases BAM1 and BAM3. This peptide promotes stomatal closure by influencing abscisic acid accumulation, thereby enhancing plant resistance to dehydration stress. It serves as a valuable tool in research related to plant stress responses and water regulation mechanisms. -
B lymphocyte mitogen/polyclonal Activator
Mitogenic Pentapeptide (Tripalmitoyl pentapeptide) is a synthetic N-terminal analog of E. coli outer membrane lipoproteins that serves as a potent B lymphocyte mitogen and polyclonal activator. It plays a critical role in stimulating B cell proliferation and differentiation, making it valuable in the study of immune adjuvants. This reagent is useful for investigating immune responses and developing immunotherapeutic strategies. -
Bioactive Peptide
p70 S6 Kinase substrate is a bioactive peptide that serves as a specific substrate for p70 ribosomal S6 kinase (S6K). This peptide plays a critical role in cellular signaling pathways, particularly in protein synthesis and cell growth regulation. It is widely utilized in research applications focused on the mechanistic understanding of mTOR signaling and related cellular processes. -
Lamin Kinase
S6 peptide is a significant substrate of lamin kinase, playing a crucial role in cardiac hypertrophy induced by mechanical loading. This peptide is activated by various growth factors, making it a valuable tool for studying cellular signaling pathways related to cardiac remodeling and hypertrophic responses. Its use in research can enhance the understanding of mechanisms underlying cardiovascular diseases and developmental processes. -
Neuroprotective Peptide
TAT-EE3 is a neuroprotective peptide that disrupts the interaction between TRPM2 and N-methyl-D-aspartate receptors (NMDARs). By inhibiting TRPM2-induced increases in NMDAR surface expression and current amplitude, TAT-EE3 offers protective effects against neuronal damage. This reagent serves as an important tool for research focused on ischemic injury and related conditions, including the study of ischemic stroke both in vitro and in vivo. -
Modified TAT-CBD3 Peptide
TAT-CBD3A6K is a modified TAT-CBD3 peptide that primarily targets voltage-dependent calcium channels. This compound effectively reduces T- and R-type calcium currents in dorsal root ganglion (DRG) neurons, demonstrating notable anti-nociceptive properties. TAT-CBD3A6K has been shown to mitigate pain in a model of AIDS-induced peripheral neuropathy by preventing the CRMP-2-mediated enhancement of T- and R-type calcium channel activity, making it a valuable tool for studying pain mechanisms and peripheral neuropathy interventions. -
Depolarizing Agent
Mast cell degranulating peptide (28-49) is a depolarizing agent derived from bee venom that acts on mast cells to induce degranulation. It has been shown to elevate cyclic guanosine monophosphate (cGMP) levels in mouse cerebellar slices, implicating its role in modulating neurotransmission and signaling pathways. This peptide is valuable for research applications focused on mast cell biology and the study of neuropharmacological effects. -
Neuropeptide
YMRF-NH2 is a neuropeptide that specifically targets the FMRFa receptor (FMRFa-R), exhibiting an EC50 value of 31 nM. This compound plays a critical role in neurobiology, particularly in studies related to neuropeptide signaling pathways. YMRF-NH2 is valuable for research focusing on neurotransmission and the physiological effects of neuropeptides. -
Proatherosclerotic Peptide Hormone
GIP (22-51) human is a potent proatherosclerotic peptide hormone targeting the NF-κB signaling pathway. This 30-amino acid peptide promotes the expression of matrix metalloproteinase-8 (MMP-8) and induces proinflammatory and proatherosclerotic protein expression. Additionally, GIP (22-51) human elevates intracellular free calcium levels in THP-1-derived macrophages, making it a valuable tool for atherosclerosis research. -
Satiety Signaling Neuropeptide
Perisulfakinin is a satiety signaling neuropeptide that targets central nervous system pathways. It plays a crucial role in regulating appetite and energy balance by inhibiting the activity of neurons that promote general activity. This compound is valuable for research applications focused on understanding food intake regulation, metabolic processes, and neuropeptide functions in the context of obesity and related disorders. -
Antiwrinkle Peptide
Argireline acetate, also known as Acetyl hexapeptide-3 acetate, is a non-toxic peptide designed to target the neuromuscular junction by significantly inhibiting Ca2+-dependent neurotransmitter release, primarily acetylcholine. This mechanism leads to its notable antiwrinkle and anti-aging effects, making it valuable in cosmetic research focused on skin rejuvenation and wrinkle reduction. Further investigations can explore its applications in dermatological and cosmetic formulations aimed at improving skin texture and appearance. -
Sperm Activating Peptide
Ser-Ala-alloresact is a sperm activating peptide (SAP) that facilitates the initiation of sperm motility and fertilization processes. This peptide originates from the eggs of marine invertebrates, where it plays a crucial role in enhancing sperm activation and promoting successful fertilization events. Researchers can utilize Ser-Ala-alloresact to explore mechanisms of fertilization and assess sperm function, providing insights into reproductive biology and potential fertility treatments. -
Anorexigenic Neuropeptide
LPLRF-NH2 is an anorexigenic neuropeptide that functions as a member of the RFamide peptide family. It has demonstrated the ability to increase arterial blood pressure and modulate the electrical activity of brainstem neurons. This compound is valuable for research applications focusing on appetite regulation and central nervous system signaling pathways. -
Polypeptide Toxins
Sarafotoxin S6d is a polypeptide toxin derived from the venom of the Israeli sand boa constrictor, known for its cardiovascular effects. This compound induces significant electrocardiogram (ECG) alterations, including myocardial ischemia and hyperkalemia, while also promoting robust extracellular calcium-dependent vasoconstriction in rat aorta and positive inotropic effects in rat atria. Sarafotoxin S6d is valuable in the investigation of cardiovascular pathologies and related physiological mechanisms. -
Palmitoylated Peptide Derivative
Palmitoyl glutathione is a palmitoylated peptide derivative that serves as a liver-targeted liposome-forming agent. It effectively forms liposome-like vesicles in conjunction with cholesterol, enabling the encapsulation of water-soluble solutes while maintaining stability in fresh rat plasma at 37°C. This compound is particularly relevant for research applications related to acetaminophen-induced liver necrosis, providing a valuable tool for studying liver pathology and therapeutic interventions.
