Catalog No.
Product Name
Application
Product Information
Citations
-
Peptide
Pancreastatin (swine) is a 49-residue peptide that primarily inhibits glucose-induced insulin release by targeting pancreatic beta cells. This peptide is derived from the porcine pancreas and plays a significant role in the regulation of glucose metabolism and insulin secretion. It is useful in research applications focused on diabetes, metabolic disorders, and the physiological roles of peptide hormones. -
Cell-penetrating Peptide
(Arg)9, also known as Nona-L-arginine, functions as a cell-penetrating peptide due to its composition of nine arginine residues. This peptide acts as an inhibitor of the serine endoprotease Furin and demonstrates significant neuroprotective activity, with an IC50 of 0.78 μM in glutamic acid-induced models. (Arg)9 is valuable in research applications targeting cellular delivery systems and neuroprotection studies. -
Peptide
Thioether-cyclized helix B peptide, CHBP, targets the mTOR signaling pathway to modulate autophagy. This peptide enhances metabolic stability and exhibits renoprotective effects by inhibiting mTORC1 while activating mTORC2. Its unique properties make it a valuable reagent for researching cellular metabolism and kidney protection mechanisms. -
E3 Ligase Peptide Ligand
ErbB2 peptide is a ligand for E3 ubiquitin ligase that specifically targets the PI3K pathway. This peptide is crucial for the development of peptide-based PROTACs, enabling selective degradation of proteins involved in various cellular processes. It is valuable for research applications focused on targeted protein degradation and signaling pathway modulation. -
Prion Peptide Fragment
PrP (106-126) is a synthetic peptide corresponding to the amyloidogenic region of the prion protein (PrP). This fragment exhibits biochemical properties similar to the infectious form of prion protein, making it crucial for the study of prion diseases. It is commonly utilized in research applications involving prion biology, amyloid formation, and the mechanisms underlying neurodegenerative disorders. -
Peptide Mimics
ccβ is a 17-amino acid peptide designed to mimic the conformational transition of proteins from α-helix to β-sheet. This transition is crucial in the aggregation of proteins linked to various neurodegenerative diseases, including Alzheimer's disease and prion diseases. ccβ serves as a valuable tool for investigating mechanisms of protein aggregation and its implications in disease pathology. -
Tau fragment R2
Tau Peptide (275-305) targets the second repeat domain of the tau protein, which plays a critical role in microtubule binding and is implicated in Alzheimer's disease. This peptide specifically interacts with group IIB metal ions (Zn²⁺, Cd²⁺, Hg²⁺), facilitating conformational changes and promoting pathological accumulation. Research applications include investigating the effects of heavy metals on tau protein dynamics and their contributions to neurodegenerative disease mechanisms. -
Tau Fragment
Tau Peptide (273-284) is a truncated fragment of the Tau protein, primarily involved in neurofibrillary tangles associated with tauopathies. This peptide is valuable for studying the molecular mechanisms of Alzheimer's disease and other related neurodegenerative disorders. It serves as a tool for elucidating Tau aggregation processes and investigating potential therapeutic interventions targeting Tau-related pathologies. -
Polypeptide
Tau Peptide (255-314) (Repeat 2 Domain) (human) is a polypeptide derived from the Tau-F protein, specifically the 255-314 fragment of this key isoform. This peptide encompasses critical aggregation sequences PHF6* (275-280, VQIINK) and PHF6 (306-311, VQIVYK), which play a significant role in Tau aggregation. It spans the C-terminal half of the repeat domain R1, the entire repeat domain R2, and the N-terminal half of repeat domain R3, making it vital for studies on Tau-related neurodegenerative processes and microtubule dynamics. -
Tau fragment
Tau Peptide (244-274) targets the Repeat 1 domain of the tau protein, a key player in neurodegenerative diseases such as Alzheimer's. This peptide fragment is commonly utilized in research to study tau pathology, including phosphorylation and aggregation processes associated with tau-mediated toxicity. Its role in modulating tau interactions makes it a valuable tool for investigating tau-related mechanisms in various cellular models. -
Tau fragment
Tau Peptide (245-274) (Repeat 1 Domain) is a specific fragment of the Tau protein that serves as a crucial target in neurodegenerative research. This peptide is involved in the formation of neurofibrillary tangles, which are characteristic of Alzheimer's disease and other tauopathies. It can be used in studies investigating tau aggregation and toxicity, as well as in the development of therapeutics aimed at modulating tau pathology. -
Tau fragment
Tau Peptide (294-305) (human) is a biologically active fragment of the Tau protein that plays a critical role in neurodegenerative diseases, particularly in Alzheimer’s disease. This peptide is instrumental in studying tau pathology, including tau aggregation and neurofibrillary tangles. It serves as an important tool for researchers investigating the mechanisms of tau-related neurodegeneration and developing potential therapeutic approaches. -
Tau fragment
Tau Peptide (45-73) (Exon 2/Insert 1 Domain) is a fragment of the Tau protein that plays a crucial role in stabilizing microtubules. This peptide is often used in research studies focusing on neurodegenerative diseases, particularly Alzheimer's disease, where Tau pathology is implicated. It serves as a valuable tool for investigating Tau aggregation, cellular interactions, and the effects of post-translational modifications on Tau function. -
Polypeptide
Tau Peptide (274-288) is a polypeptide that plays a significant role in neurobiology through its interaction with tau protein. This peptide is widely utilized in research applications focused on protein-protein interactions, functional analyses, and epitope mapping. It serves as a valuable tool in the exploration of tau-related pathologies, aiding in the understanding of neurodegenerative diseases such as Alzheimer's. -
Tau fragment
Tau Peptide (306-336) (Repeat 3 Domain) targets the Tau protein, specifically the repeat domain that plays a crucial role in microtubule stabilization. This peptide fragment facilitates studies on Tau's involvement in neurodegenerative diseases, particularly Alzheimer's disease, by helping to elucidate the mechanisms of Tau aggregation and function. It serves as a valuable tool for researchers investigating Tau-related pathology and potential therapeutic interventions. -
Tau fragment
Tau Peptide (379-408) is a specific fragment of the tau protein, which is integral to neurodegenerative research, particularly in the study of tauopathies. This peptide serves as a crucial tool for understanding tau aggregation, neurofibrillary tangles formation, and synaptic dysfunction. Its applications include investigating mechanisms of tau-related pathologies and evaluating therapeutic interventions targeting tau misfolding and toxicity. -
Tau Peptide
Acetyl-PHF5 amide is a tau peptide that demonstrates amyloidogenic properties, facilitating the polymerization into filamentous structures. This compound is valuable for research into tau-related pathologies, such as Alzheimer's disease, and is used to study the mechanisms of tau aggregation and neurodegeneration. Its ability to replicate key features of tau protein behavior makes it an essential tool for investigating therapeutic strategies targeting tauopathies. -
Tau fragment
Tau Peptide (1-16) (human) is a fragment of the Tau protein, primarily targeting Tau-mediated pathways involved in neurodegenerative diseases. This peptide is crucial for studying the role of Tau in processes such as microtubule stabilization and neurofibrillary tangle formation. It serves as an important tool for research applications focused on Alzheimer's disease and other tauopathies. -
Tau fragment
Tau Peptide (74-102) (Exon 3/Insert 2 Domain) is a specific fragment of the tau protein that plays a crucial role in stabilizing microtubules in neurons. This peptide is instrumental in research focusing on tauopathies, including Alzheimer’s disease, where tau aggregation and dysfunction are key pathological features. By utilizing this peptide, researchers can investigate tau-related mechanisms and develop potential therapeutic strategies for neurodegenerative disorders. -
α-Synuclein Knockdown Peptide
Tat-βsyn-degron is an α-synuclein knockdown peptide that promotes the degradation of α-synuclein through the proteasome pathway. This compound demonstrates significant efficacy in reducing α-synuclein protein levels in primary rat cortical neuron cultures. Additionally, Tat-βsyn-degron has shown potential in alleviating parkinsonian toxin-induced neuronal damage and movement disorders in a Parkinson's mouse toxicity model, making it a valuable tool for research into neurodegenerative diseases. -
Peptidoglycan pentapeptide
Ala-D-γ-Glu-Lys-D-Ala-D-Ala TFA is a synthetic peptidoglycan pentapeptide that serves as a crucial component of bacterial cell wall biosynthesis. This compound mimics the pentapeptide tail of the peptidoglycan precursor UDP-MurNAc-l-Ala-γ-d-Glu-l-Lys(Gly)(5)-d-Ala-d-Ala. It is primarily used in research focusing on antibiotic development and studies of bacterial growth, cell wall integrity, and resistance mechanisms. This reagent is essential for examining the biochemical pathways involved in peptidoglycan synthesis and the structural analysis of bacterial cell walls. -
Dipeptide
H-Val-Tyr-OH is a dipeptide composed of valine and tyrosine linked by a peptide bond. It has been identified as a potential inhibitor of IKKα, making it valuable for studying cancer and inflammatory diseases. This compound can aid in elucidating the role of IKKα in various biological processes and could contribute to the development of therapeutic strategies targeting related pathways. -
Glioblastoma-Targeting Nonapeptide
CooP is a linear glioblastoma-targeting nonapeptide that specifically binds to the mammary-derived growth inhibitor/fatty acid binding protein 3 (FABP3) found in glioblastoma cells and their associated vasculature. This peptide facilitates the targeted delivery of chemotherapy agents and various nanoparticles, enhancing therapeutic efficacy while minimizing off-target effects. Its application in glioblastoma research provides insights into novel treatment strategies for this challenging cancer type. -
Anticoagulant Peptide
E-76 is an anticoagulant peptide that specifically inhibits blood coagulation by binding to exogenous coagulation factor VIIa (FVIIa). This interaction disrupts the coagulation cascade, making E-76 a valuable tool for studying blood coagulation disorders and related pathophysiological conditions. Its application extends to research focused on thrombotic diseases and therapeutics targeting coagulation pathways. -
Fluorescent Peptide
Boc-Ile-Glu-Gly-Arg-AMC is a fluorogenic peptide substrate specifically designed for the activated factor X (FXa). This compound exhibits key biological activity by enabling the quantification of FXa in various biological assays. It is particularly useful in research applications focused on coagulation, thrombin generation, and related hemostatic studies. -
Chromogenic Peptide Substrate
Bz-Pro-Phe-Arg-pNA hydrochloride is a chromogenic peptide substrate specifically designed for the detection of plasma and glandular Kallikrein, cysteine proteinase (Cruzipain), and Trypsin. This compound exhibits significant biological activity as it enables the quantification of enzymatic activities in various assays, including the Factor XII assay. Its application in enzymology provides valuable insights into proteolytic processes and enzyme kinetics. -
IDO Peptide
Imsamotide, also known as IDO194-214, is an Indoleamine 2,3-Dioxygenase (IDO) peptide with the sequence DTLLKALLEIASCLEKALQVF. This compound serves as an immunological agent for active immunization, contributing to the modulation of immune responses. Additionally, Imsamotide exhibits potential antineoplastic properties, making it a valuable tool in cancer research and immunotherapy applications. -
LDL Receptor Peptide Fragment
Milpocitide is a peptide fragment derived from the low-density lipoprotein receptor (LDLR), specifically corresponding to the EGF-like domain 1 (residues 293-333). This compound is crucial for studying the mechanistic roles of LDLR in cholesterol metabolism and atherosclerosis. Milpocitide serves as a valuable tool for researchers investigating LDL receptor functionality and its implications in lipid disorders. -
Lung Endothelial Targeted Peptide
GALA is a pH-responsive amphipathic peptide that specifically targets lung endothelium. It undergoes a conformational change from random coil to α-helix at pH 5.0, leading to endosomal membrane destabilization and fusion. GALA-modified liposomes utilize clathrin-dependent endocytosis and transcytosis for efficient delivery, accumulating in lung tissues post-intravenous administration. This peptide enhances the cytosolic release of therapeutic agents such as siRNA and plasmids, facilitating increased gene transfection efficiency while maintaining low cytotoxicity. GALA is a valuable tool for investigating lung cancer metastasis and developing lung-targeted drug delivery systems. -
Peptide
Furin Substrate is a peptide designed for the study of the furin enzyme, a proprotein convertase involved in the processing of various proteins. It serves as a valuable tool for investigating proteolytic cleavage and enzyme activity in biochemical research. Applications include studying the role of furin in disease mechanisms and identifying potential therapeutic targets in related pathways. -
GluR6/PSD-95 Inhibitor
PDZ1 Domain Inhibitor Peptide is a cyclic peptide designed to specifically target the PDZ1 domains of postsynaptic density protein 95 (PSD-95). By disrupting the interaction between GluR6 and PSD-95, this inhibitor effectively competes with the C terminus of GluR6 for binding to the PDZ1 domain. Its unique β-Ala lactam side chain linker enhances its efficacy in studies related to synaptic signaling and glutamate receptor regulation. This reagent is ideal for research applications focusing on neuronal communication and synaptic plasticity. -
Peptide
YHIEPV (rALP-2, Rubisco anxiolytic-like peptide 2) is an orally active peptide that targets the central nervous system to exhibit anxiolytic effects. This peptide enhances leptin sensitivity, contributing to its anti-obesity activity. YHIEPV is useful in research focused on anxiety modulation and metabolic regulation. -
NMDA Antagonist Peptide
Conantokin-T is a γ-carboxyglutamate-containing peptide that acts as an NMDA receptor antagonist, exhibiting an IC50 value of 2 μM. This compound inhibits NMDA receptor-mediated calcium influx in central nervous system neurons, making it a valuable tool for studying synaptic transmission and neurotoxicity. Derived from the venom of the fish-hunting cone snail, Conus tulipa, Conantokin-T is useful in research applications related to neuropharmacology and neurological disorders. -
Peptide Inhibitor
p-fin4 is a peptide inhibitor targeting the interaction between STEP phosphatase and the GluA2 subunit of the AMPA receptor, with a Ki of 0.4 μM. This compound has demonstrated the ability to restore memory deficits and exhibits anxiolytic and antidepressant effects in a scopolamine-induced rat model. p-fin4 represents a potential lead for the development of innovative cognitive enhancers and behavioral modulators, highlighting its significance in neurological research. -
Pep2-SVKI Control Peptide
Pep2-SVKE is an inactive control peptide designed for use with Pep2-SVKI. This peptide corresponds to the last ten amino acids of the C-terminus of the GluR2 AMPA receptor subunit, and does not inhibit AMPA-mediated [3H]DA exocytosis. Moreover, Pep2-SVKE does not interact with GRIP or PICK43, nor does it interfere with the retention of PICK1 by GST-GluR2 in long-term depression (LTD) studies. It is an essential tool for researchers evaluating the specific effects of Pep2-SVKI in their experiments. -
Excitatory Peptide
N-Acetylglycyl-D-glutamic acid is an excitatory peptide that acts on the central nervous system by inducing seizures in murine models. This compound serves as a valuable tool for studying seizure mechanisms and the role of excitatory neurotransmission in neurobiology. Its application in research aids in understanding the pathophysiology of epilepsy and related disorders. -
Pep2m Control Peptide
Pep4c is an inactive control peptide designed to serve as a negative counterpart to Pep2m, which specifically disrupts interactions between Protein Interacting with C Kinase 1 (PICK1) and AMPA receptor subunit GluA2, as well as N-ethylmaleimide-sensitive factor (NSF) and GluA2. This control peptide lacks the capacity to affect AMPA receptor trafficking and synaptic plasticity, making it suitable for validating the specificity of experimental results involving Pep2m. Researchers utilize Pep4c to ensure the accuracy of their findings in studies related to these key protein interactions. -
Bioactive Peptide
GluR23Y is a bioactive peptide targeting AMPA receptors. It has demonstrated the ability to inhibit insulin-mediated endocytosis of native AMPA receptors in cultured hippocampal neurons, as evidenced by its use in ELISA cell-surface assays. By preventing the insulin-induced reduction in receptor availability, GluR23Y serves as a valuable tool for research on synaptic plasticity and insulin signaling pathways in neural contexts. -
α2δ-1 C Terminus Mimicking Peptide
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide designed to mimic the C-terminal domain of the α2δ-1 protein, also referred to as the α2δ-1Tat peptide. This peptide is capable of effectively disrupting the interaction between α2δ-1 and N-methyl-D-aspartate receptors (NMDARs) both in vitro and in vivo. It is a valuable tool for research into the mechanisms underlying neuropathic pain, aiding in the exploration of targeted therapeutic interventions. -
Na+/K+ ATPase Inhibitor
Transdermal Peptide Disulfide is a synthetic 11-amino acid peptide that serves as an inhibitor of the Na+/K+-ATPase by binding to the beta-subunit (ATP1B1) and specifically interacting with its C-terminus. This compound enhances the transdermal delivery of various macromolecules, making it a valuable tool in drug formulation and transdermal research applications. Its ability to facilitate the transport of biologically relevant molecules may have significant implications for improving therapeutic delivery in clinical settings. -
Synthetic Peptide
AChRα(97-116) is a synthetic peptide derived from the 97-116 sequence of the rat acetylcholine receptor α-subunit, serving as an important tool for research involving autoimmune diseases, particularly experimental autoimmune myasthenia gravis. This peptide is instrumental in elucidating the mechanisms of autoimmunity and the pathophysiology of neuromuscular junction disorders. Its application in research may provide insights into therapeutic targets and disease progression. -
Pleiotropic Peptide
Catestatin (human) is a pleiotropic peptide that acts as a catecholamine release-inhibitory peptide. It exhibits key biological activities, including antihypertensive effects and angiogenesis promotion, thereby contributing to cardiovascular protection. This reagent is valuable for researching inflammatory diseases and other conditions associated with dysregulated catecholamine levels. -
nAChRs antagonist
Pentapeptide-3 is a pentapeptide derived from the neurotoxin waglerin-1, sourced from Temple Viper venom. It functions as a competitive antagonist of nicotinic acetylcholine receptors (nAChRs), effectively blocking nerve transmission at the post-synaptic membrane. Due to its ability to inhibit nAChRs, Pentapeptide-3 exhibits potential anti-aging effects and is often utilized in conjunction with other cosmetic peptides for research applications related to skin rejuvenation. -
Peptide
[D-Trp7,9,10]-Substance P is an analogue of substance P, primarily targeting substance P receptors. It exhibits the dual activity of stimulating these receptors while simultaneously inhibiting ion conductance through nicotinic acetylcholine receptors. This compound is useful in research applications focused on neuropeptide signaling and the modulation of pain pathways. Its unique pharmacological profile makes it a valuable tool for investigating receptor interactions and their downstream effects in various biological systems. -
Calmodulin Ligand
Calmodulin Binding Peptide 1 is a high-affinity ligand for calmodulin (CaM), originating from smooth muscle myosin light chain kinase. This peptide exhibits pM binding affinity and specifically interacts with Ca2+-bound calmodulin, facilitating the study of smooth muscle contraction mechanisms. It serves as an important tool for research applications aimed at selectively regulating calmodulin activity and developing therapeutic agents targeting calmodulin-related pathways. -
CaM kinase II Polypeptide
Calmodulin-Dependent Protein Kinase II (281-309) is a peptide corresponding to the regulatory domain of calcium/calmodulin-dependent protein kinase II (CaM-kinase II). This peptide plays a critical role in the regulation of various physiological processes, including synaptic plasticity and memory formation. It is utilized in research applications involving calcium signaling pathways, protein phosphorylation, and the study of neuronal function. -
CaM Binding Peptide
MLCK Peptide is a high-affinity (pM) calcium/calmodulin (CaM)-binding peptide derived from smooth muscle myosin light-chain kinase. This peptide serves as a valuable tool for studying CaM-mediated signaling pathways and muscle contraction mechanisms. Its reversible binding properties make it suitable for various applications in biochemical and physiological research, particularly in investigations of calcium signaling and muscle physiology. -
Tetrapeptide
H-Leu-Trp-Met-Arg-OH is a tetrapeptide that serves as a substrate for aminopeptidase-mediated hydrolysis studies. This compound allows researchers to investigate enzyme kinetics and activity, contributing to the understanding of peptide metabolism and regulation. Its applications extend to studies in proteomics and enzymology, facilitating advancements in biochemical research. -
CD13-binding Peptide
Aminopeptidase N Ligand (CD13) NGR peptide specifically targets CD13, serving as an effective carrier for facilitating intracellular transport. This polypeptide exhibits significant binding affinity to CD13, making it a valuable tool in cancer research. Its ability to mediate transport processes enhances its utility in studying tumor biology and therapeutic applications. -
Neuropeptide
Antho-rwamide I is a neuropeptide derived from the sea anemone Anthopleura elegantissima, known for its resistance to nonspecific aminopeptidases. This stability enhances its potential for sustained signaling after neuronal release, making it a valuable tool for studying neuropeptide interactions and mechanisms in neurobiology. Antho-rwamide I is applicable in research focused on neuronal signaling pathways and neuropeptide function.
