Catalog No.
Product Name
Application
Product Information
Citations
-
Hormone Peptide
Human follicular gonadotropin releasing peptide (hF-GRP) is a hormone peptide that primarily stimulates the secretion of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) from the pituitary gland. This peptide plays a crucial role in regulating reproductive processes by enhancing gonadotropin release. hF-GRP is valuable for research applications involving reproductive endocrinology, fertility studies, and the regulation of hormonal pathways. -
GAP
GnRH Associated Peptide (1-24), human is a fragment of the human gonadotropin-releasing hormone-associated peptide (GAP) comprising residues 1-24. This peptide is linked to the luteinizing hormone-releasing hormone (LH-RH) sequence via a three-amino-acid processing site, playing a critical role in reproductive hormone regulation. It is primarily utilized in research to study the mechanisms of gonadotropin release and the modulation of fertility-related pathways. -
Peptide
(Ser(tBu)6,Azagly10)-LHRH is a potent aza-GLY analog targeting gonadotropin-releasing hormone receptors. This peptide exhibits significant biological activity in modulation of hormonal signaling pathways, making it valuable for research in reproductive biology and endocrine regulation. It is particularly useful for studies aimed at understanding potentiation and inhibition of luteinizing hormone release in various biological systems. -
Polypeptide
(D-Leu6)-LHRH (1-8) is a synthetic polypeptide known for its role as a gonadotropin-releasing hormone analogue, primarily targeting the pituitary gland. It exhibits significant biological activity by modulating hormonal release, making it valuable in studies of reproductive physiology and endocrinology. This reagent is widely utilized in peptide screening for protein interactions, functional analysis, and epitope mapping, advancing research in therapeutic agent development. -
Peptide
(D-His2)-Goserelin is a peptide analog derived from Goserelin, which mimics the structure of gonadotropin-releasing hormone (GnRH/LHRH). This compound serves primarily as an agonist of GnRH receptors, influencing the secretion of luteinizing hormone (LH) and follicle-stimulating hormone (FSH). Its biological activity makes it valuable in research focused on reproductive biology, endocrinology, and fertility treatments. -
Polypeptide
(Des-Gly10,D-His2,D-Trp6,Pro-NHEt9)-LHRH is a synthetic polypeptide that serves as a potent analog of Luteinizing Hormone-Releasing Hormone (LHRH), targeting the neuroendocrine system. It exhibits significant biological activity in regulating hormone release, making it valuable for research applications related to reproductive biology and endocrine function. This reagent can facilitate peptide screening studies for immunoassays, protein interactions, and functional analyses, particularly in the context of drug development and therapeutic interventions. -
Polypeptide
(Des-Pyr1,Des-Gly10,D-Leu6,Pro-NHEt9)-LHRH is a synthesized polypeptide designed to modulate gonadotropin release hormone (GnRH) signaling pathways. This compound exhibits significant biological activity in influencing reproductive hormone regulation, making it a valuable tool in endocrinology research. It is particularly applicable in studies focused on peptide interactions, functional analysis, and epitope mapping, contributing to the advancement of therapeutic agents in reproductive health and related fields. -
Polypeptide
(Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt9)-LHRH is a synthesized polypeptide designed to target luteinizing hormone-releasing hormone (LHRH) receptors. This compound exhibits biological activity relevant to the modulation of reproductive hormone pathways, making it valuable in research focused on endocrine function and signaling. It is particularly useful for applications in peptide screening, protein interaction studies, and functional analysis within the context of agent development in reproductive biology. -
Polypeptide
(D-Ser6,Azagly10)-LHRH is a modified polypeptide that targets the luteinizing hormone-releasing hormone (LHRH) receptor. This compound exhibits significant activity in regulating reproductive hormone release and is utilized in research applications focusing on reproductive biology, endocrinology, and peptide-based therapies. Its utility in peptide screening enables the identification and validation of active peptides, facilitating studies on protein interactions and functional analyses in various biological contexts. -
Polypeptide
(Des-Gly10,D-Pyr1,D-Leu6,Pro-NHEt9)-LHRH is a synthetic polypeptide derivative that serves as a potent agonist of the luteinizing hormone-releasing hormone (LHRH) receptor. This compound is vital for research in endocrinology, particularly for studies investigating reproductive physiology and the regulation of gonadotropin release. Its application in peptide screening enables the identification of active peptides, offering insights into protein interactions and functional analyses within the field of pharmaceutical development. -
Polypeptide
(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt9)-LHRH is a synthetic polypeptide designed to interact with gonadotropin-releasing hormone receptors. This compound exhibits bioactivity relevant to the modulation of reproductive hormones, making it valuable in studies focused on reproductive biology and endocrine regulation. Its applications include protein interaction studies, functional assays, and epitope mapping, particularly in the context of agent research and development. -
Polypeptide
(Des-Gly10,D-Leu6,Orn8,Pro-NHEt9)-LHRH is a synthetic polypeptide that targets luteinizing hormone-releasing hormone (LHRH) receptors. It exhibits notable biological activity in modulating hormone release, making it a valuable tool in endocrinology research. Applications include protein interaction studies, functional analysis, and epitope mapping, particularly in the development of therapeutic agents and understanding hormonal regulation. -
Polypeptide
(D-Leu6,Pro-NHEt9)-LHRH (4-9) is a polypeptide designed for applications in peptide screening. This compound serves as a valuable tool for identifying active peptides primarily through immunoassay methodologies. It is particularly useful for studying protein interactions, conducting functional analyses, and performing epitope screenings, making it relevant in agent research and development within the life sciences. -
Signature Peptide
IYPTNGYTR is a deamidation-sensitive signature peptide derived from Trastuzumab, specifically designed to provide insights into the metabolic processes of this therapeutic antibody. Its detection allows for the monitoring of Trastuzumab metabolism in vivo, facilitating studies related to drug efficacy and stability. This peptide is valuable for researchers investigating antibody pharmacokinetics and therapeutic applications in oncology. -
Bioactive Peptide
MeOSuc-AAPV-AFC is a bioactive peptide that serves as a highly specific substrate for neutrophil elastase. This compound exhibits fluorescence with an excitation/emission wavelength of 380/500 nm, enabling sensitive detection and quantification in research applications. It is primarily utilized in studies focusing on proteolytic activity related to inflammation and immune response. -
Dipeptide condensation product
L-Leucyl-L-Leucine methyl ester hydrobromide is a dipeptide condensation product targeting lymphocytes with cytotoxic potential. This compound selectively induces lymphocyte elimination while also triggering endolysosomal pathway stress. It is utilized in research applications focused on immune response modulation and cellular stress mechanisms. -
Trastuzumab Signature Peptide
FTISADTSK is an endogenous stable signature peptide associated with Trastuzumab, serving as a valuable biomarker for monitoring therapeutic response. This peptide can be utilized in selected reaction monitoring (SRM) assays, facilitating quantitative analysis in oncology research. Its application extends to studies focused on trastuzumab treatment efficacy and patient stratification in breast cancer therapies. -
Cosmetic Peptide
Kitol is a cosmetic peptide primarily involved in after-sun repair formulations. It is formed from the heat-induced dimerization of vitamin A derivatives, contributing to their stability. Research applications include evaluating the heat sensitivity of vitamin A esters using microcalorimetry, thereby enhancing the understanding of the degradation processes in cosmetic formulations. -
Anti-angiogenic Peptide
Adamtsostatin 16 is an anti-angiogenic peptide comprising 17 amino acids, featuring type I thrombospondin motifs. This compound inhibits angiogenesis by interfering with endothelial cell functions, making it a valuable tool for studying vascular biology and tumor growth. Its applications include cancer research, wound healing studies, and investigations into the mechanisms of vascular development. -
Anti-angiogenic Peptide
Adamtsostatin 18 is an anti-angiogenic peptide targeting the inhibition of angiogenesis. This peptide disrupts cell migration and proliferation, making it a valuable tool for research in cancer biology and vascular development. Its mechanism of action involves interference with pathways critical for endothelial cell function, facilitating studies on tumor growth and metastasis. -
Anti-angiogenic Peptide
Adamtsostatin 4 is an anti-angiogenic peptide that inhibits angiogenesis by targeting vascular endothelial growth factor (VEGF) signaling pathways. This peptide demonstrates significant biological activity in reducing endothelial cell proliferation and migration, making it a valuable tool in cancer research and therapeutic development aimed at combating tumors. Its application extends to studies focused on angiogenesis-related diseases and the evaluation of anti-angiogenic strategies. -
Tetrapeptide
H-Leu-Trp-Met-Arg-OH is a tetrapeptide that serves as a substrate for aminopeptidase-mediated hydrolysis studies. This compound allows researchers to investigate enzyme kinetics and activity, contributing to the understanding of peptide metabolism and regulation. Its applications extend to studies in proteomics and enzymology, facilitating advancements in biochemical research. -
CD13-binding Peptide
Aminopeptidase N Ligand (CD13) NGR peptide specifically targets CD13, serving as an effective carrier for facilitating intracellular transport. This polypeptide exhibits significant binding affinity to CD13, making it a valuable tool in cancer research. Its ability to mediate transport processes enhances its utility in studying tumor biology and therapeutic applications. -
Neuropeptide
Antho-rwamide I is a neuropeptide derived from the sea anemone Anthopleura elegantissima, known for its resistance to nonspecific aminopeptidases. This stability enhances its potential for sustained signaling after neuronal release, making it a valuable tool for studying neuropeptide interactions and mechanisms in neurobiology. Antho-rwamide I is applicable in research focused on neuronal signaling pathways and neuropeptide function. -
Substrate Peptide
Acetyltrialanine is a peptide substrate designed for Nα-acetyl alanine aminopeptidase, facilitating the investigation of enzyme activity and characteristics. This compound enables research into protein degradation and N-terminal regulation, making it a valuable tool for understanding proteolytic processes and related biological mechanisms. Its unique features allow for precise studies of enzyme kinetics and specificity in various biological contexts. -
Tripeptide
Suc-Ala-Ala-Pro-Leu-pNA is a tripeptidyl p-nitroanilide substrate that serves as a specific tool for studying the catalytic activity of acyl amidase-like leucine aminopeptidase in seminal plasma. This reagent enables the assessment of hydrolytic activity, making it valuable in investigations related to reproductive health, particularly in the context of azoospermia. Researchers can utilize Suc-Ala-Ala-Pro-Leu-pNA to explore the enzymatic mechanisms and potential therapeutic targets in male fertility disorders. -
Anti-angiogenic Peptide
Cartilostatin 1 is an anti-angiogenic peptide that inhibits the formation of new blood vessels. It exhibits significant potential in modulating angiogenesis, making it a valuable tool for research in cancer biology, wound healing, and other conditions where vascular growth regulation is crucial. Its biological activity may be leveraged in studies exploring therapeutic strategies for diseases characterized by aberrant angiogenesis. -
Apolipoprotein Peptide
APL180 is an apolipoprotein A-I mimic peptide that enhances the anti-inflammatory activity of high-density lipoprotein (HDL). This compound is valuable in research focused on cardiovascular diseases, leveraging its properties to study HDL's role in inflammation and lipid metabolism. -
Peptide
Dansyl-Ala-Arg is a synthetic peptide that serves as a fluorescent probe targeting various biochemical processes. It is commonly utilized in studies involving peptide interactions, protein conformation, and cellular imaging. Its unique fluorescent properties make it an effective tool for monitoring biological events in live cells and in vitro assays. -
Depsipeptide Substrate for DD-carboxypeptidases
Ac-Lys(Ac)-D-Ala-D-Lactic acid serves as a depsipeptide substrate specifically targeting DD-carboxypeptidases, which are penicillin-sensitive D-alanine carboxypeptidases. This compound is utilized in research to investigate the enzymatic activity and functionality of these peptidases, playing a crucial role in bacterial cell wall synthesis and maintenance. Its application in enzymatic studies provides insights into antibiotic action mechanisms and potential resistance pathways. -
Peptide Toxin
Poneratoxin is a peptide toxin that acts as a modulator of voltage-gated sodium channels (NaV), specifically NaV1.6 and NaV1.7, with EC50 values of 97 nM and 2.3 µM, respectively. It lowers the voltage threshold for channel activation and inhibits their inactivation, thereby enhancing neuronal excitability. This activity is relevant in studies of pain signal transmission and neuropathic pain research, making Poneratoxin a valuable tool in neurobiology and pharmacological investigations. -
Peptide
ApoA-I mimetic peptide is a synthetic peptide designed to mimic the activity of apolipoprotein A-I, targeting lipid metabolism pathways. It exhibits effective activation of lecithin:cholesterol acyltransferase (LCAT), facilitating the formation of peptide/lipid complexes. This reagent is useful in research related to atherosclerosis, aiding in the study of cholesterol regulation and plaque formation. The peptide sequence is PVLDLFRELLNELLEALKQKLK. -
Cationic Amphiphilic Lytic Peptide
L17E is an attenuated cationic amphiphilic lytic peptide that facilitates the delivery of macromolecules, including proteins, antibodies, and DNA nanostructures. Its mechanism involves membrane insertion and cleavage via electrostatic interactions, promoting intracellular escape. The effectiveness of L17E is closely linked to the expression of KCNN4, encoding the calcium-activated potassium channel KCa3.1, and it enhances cellular uptake through the induction of micropinocytosis. Additionally, L17E can be optimized through dimerization and combined with other delivery systems, such as nuclear localization signal peptides and cell membrane-coated nanoparticles, for improved performance in research applications. -
Neuroactive peptide
β-Bag cell peptide is a neuroactive peptide that primarily acts on bag cell neurons, elevating cyclic AMP levels. This elevation in cyclic AMP is associated with the modulation of neurophysiological processes, while β-Bag cell peptide also reduces the amplitudes of voltage-dependent potassium currents. This compound is useful for studies exploring neuronal signaling pathways and the physiological roles of neuropeptides in the nervous system. -
Bioactive Peptide
Caloxin 1B1 is a bioactive peptide that selectively targets the extracellular domain 1 of the plasma membrane calcium ATPase 4 (PMCA4). Its high affinity for PMCA4, compared to PMCA1, enables effective modulation of calcium transport. Caloxin 1B1 can be directly applied to cells and tissues, making it a valuable tool for investigating its effects on smooth muscle and endothelial function in various research applications. -
GluR6/PSD-95 Inhibitor
PDZ1 Domain Inhibitor Peptide is a cyclic peptide designed to specifically target the PDZ1 domains of postsynaptic density protein 95 (PSD-95). By disrupting the interaction between GluR6 and PSD-95, this inhibitor effectively competes with the C terminus of GluR6 for binding to the PDZ1 domain. Its unique β-Ala lactam side chain linker enhances its efficacy in studies related to synaptic signaling and glutamate receptor regulation. This reagent is ideal for research applications focusing on neuronal communication and synaptic plasticity. -
Peptide
YHIEPV (rALP-2, Rubisco anxiolytic-like peptide 2) is an orally active peptide that targets the central nervous system to exhibit anxiolytic effects. This peptide enhances leptin sensitivity, contributing to its anti-obesity activity. YHIEPV is useful in research focused on anxiety modulation and metabolic regulation. -
NMDA Antagonist Peptide
Conantokin-T is a γ-carboxyglutamate-containing peptide that acts as an NMDA receptor antagonist, exhibiting an IC50 value of 2 μM. This compound inhibits NMDA receptor-mediated calcium influx in central nervous system neurons, making it a valuable tool for studying synaptic transmission and neurotoxicity. Derived from the venom of the fish-hunting cone snail, Conus tulipa, Conantokin-T is useful in research applications related to neuropharmacology and neurological disorders. -
Peptide Inhibitor
p-fin4 is a peptide inhibitor targeting the interaction between STEP phosphatase and the GluA2 subunit of the AMPA receptor, with a Ki of 0.4 μM. This compound has demonstrated the ability to restore memory deficits and exhibits anxiolytic and antidepressant effects in a scopolamine-induced rat model. p-fin4 represents a potential lead for the development of innovative cognitive enhancers and behavioral modulators, highlighting its significance in neurological research. -
Pep2-SVKI Control Peptide
Pep2-SVKE is an inactive control peptide designed for use with Pep2-SVKI. This peptide corresponds to the last ten amino acids of the C-terminus of the GluR2 AMPA receptor subunit, and does not inhibit AMPA-mediated [3H]DA exocytosis. Moreover, Pep2-SVKE does not interact with GRIP or PICK43, nor does it interfere with the retention of PICK1 by GST-GluR2 in long-term depression (LTD) studies. It is an essential tool for researchers evaluating the specific effects of Pep2-SVKI in their experiments. -
Excitatory Peptide
N-Acetylglycyl-D-glutamic acid is an excitatory peptide that acts on the central nervous system by inducing seizures in murine models. This compound serves as a valuable tool for studying seizure mechanisms and the role of excitatory neurotransmission in neurobiology. Its application in research aids in understanding the pathophysiology of epilepsy and related disorders. -
Pep2m Control Peptide
Pep4c is an inactive control peptide designed to serve as a negative counterpart to Pep2m, which specifically disrupts interactions between Protein Interacting with C Kinase 1 (PICK1) and AMPA receptor subunit GluA2, as well as N-ethylmaleimide-sensitive factor (NSF) and GluA2. This control peptide lacks the capacity to affect AMPA receptor trafficking and synaptic plasticity, making it suitable for validating the specificity of experimental results involving Pep2m. Researchers utilize Pep4c to ensure the accuracy of their findings in studies related to these key protein interactions. -
Bioactive Peptide
GluR23Y is a bioactive peptide targeting AMPA receptors. It has demonstrated the ability to inhibit insulin-mediated endocytosis of native AMPA receptors in cultured hippocampal neurons, as evidenced by its use in ELISA cell-surface assays. By preventing the insulin-induced reduction in receptor availability, GluR23Y serves as a valuable tool for research on synaptic plasticity and insulin signaling pathways in neural contexts. -
α2δ-1 C Terminus Mimicking Peptide
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide designed to mimic the C-terminal domain of the α2δ-1 protein, also referred to as the α2δ-1Tat peptide. This peptide is capable of effectively disrupting the interaction between α2δ-1 and N-methyl-D-aspartate receptors (NMDARs) both in vitro and in vivo. It is a valuable tool for research into the mechanisms underlying neuropathic pain, aiding in the exploration of targeted therapeutic interventions. -
Na+/K+ ATPase Inhibitor
Transdermal Peptide Disulfide is a synthetic 11-amino acid peptide that serves as an inhibitor of the Na+/K+-ATPase by binding to the beta-subunit (ATP1B1) and specifically interacting with its C-terminus. This compound enhances the transdermal delivery of various macromolecules, making it a valuable tool in drug formulation and transdermal research applications. Its ability to facilitate the transport of biologically relevant molecules may have significant implications for improving therapeutic delivery in clinical settings. -
Synthetic Peptide
AChRα(97-116) is a synthetic peptide derived from the 97-116 sequence of the rat acetylcholine receptor α-subunit, serving as an important tool for research involving autoimmune diseases, particularly experimental autoimmune myasthenia gravis. This peptide is instrumental in elucidating the mechanisms of autoimmunity and the pathophysiology of neuromuscular junction disorders. Its application in research may provide insights into therapeutic targets and disease progression. -
Pleiotropic Peptide
Catestatin (human) is a pleiotropic peptide that acts as a catecholamine release-inhibitory peptide. It exhibits key biological activities, including antihypertensive effects and angiogenesis promotion, thereby contributing to cardiovascular protection. This reagent is valuable for researching inflammatory diseases and other conditions associated with dysregulated catecholamine levels. -
nAChRs antagonist
Pentapeptide-3 is a pentapeptide derived from the neurotoxin waglerin-1, sourced from Temple Viper venom. It functions as a competitive antagonist of nicotinic acetylcholine receptors (nAChRs), effectively blocking nerve transmission at the post-synaptic membrane. Due to its ability to inhibit nAChRs, Pentapeptide-3 exhibits potential anti-aging effects and is often utilized in conjunction with other cosmetic peptides for research applications related to skin rejuvenation. -
Peptide
[D-Trp7,9,10]-Substance P is an analogue of substance P, primarily targeting substance P receptors. It exhibits the dual activity of stimulating these receptors while simultaneously inhibiting ion conductance through nicotinic acetylcholine receptors. This compound is useful in research applications focused on neuropeptide signaling and the modulation of pain pathways. Its unique pharmacological profile makes it a valuable tool for investigating receptor interactions and their downstream effects in various biological systems. -
Calmodulin Ligand
Calmodulin Binding Peptide 1 is a high-affinity ligand for calmodulin (CaM), originating from smooth muscle myosin light chain kinase. This peptide exhibits pM binding affinity and specifically interacts with Ca2+-bound calmodulin, facilitating the study of smooth muscle contraction mechanisms. It serves as an important tool for research applications aimed at selectively regulating calmodulin activity and developing therapeutic agents targeting calmodulin-related pathways.
