Catalog No.
Product Name
Application
Product Information
Citations
-
ACE Inhibitory Peptide
Ser-Ala-Pro is an angiotensin-converting enzyme (ACE) inhibitory peptide characterized by an X-Pro structure. This compound exhibits significant potential in the study of hypertension, facilitating research into blood pressure regulation and cardiovascular health. Its mechanism of action makes it a valuable tool for exploring ACE-related pathways in various biological settings. -
TRAF6-p62 Inhibitor
TRAF6 peptide is a selective inhibitor of the TRAF6-p62 interaction. It effectively disrupts the ubiquitination of TrkA in NGF-dependent signaling pathways. This peptide demonstrates significant potential for research in neurological disorders, including Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, traumatic brain injury, epilepsy, and stroke. -
TRAF6 Control Peptide
TRAF6 Control Peptide is a synthetic peptide designed to serve as a control in studies involving Tumor Necrosis Factor Receptor-Associated Factor 6 (TRAF6). This peptide is crucial for validating experimental results related to TRAF6 signaling pathways, which are implicated in immune response and inflammation. Its application extends to research involving ubiquitination processes and the modulation of various cellular functions influenced by TRAF6 activity. -
Bioactive Peptide
LL-37(17-32) is a bioactive peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide LL-37. This peptide has demonstrated the ability to reverse ABCG2-mediated multidrug resistance in various cancer cell lines. Its biological activity makes LL-37(17-32) a valuable tool for research in cancer therapy and drug resistance mechanisms. -
Antimicrobial Peptide
Ranalexin is an antimicrobial peptide that exhibits significant activity against bacterial pathogens. It demonstrates effective inhibition of Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa, with minimum inhibitory concentrations (MICs) of 4, 32, and 128 μg/mL, respectively. Ranalexin is relevant for research applications focused on antimicrobial resistance and the development of peptide-based therapies. -
Antimicrobial Peptide
Arenicin-1 is an antimicrobial peptide derived from the coelomocytes of the marine polychaete Arenicola marina. It exhibits significant antimicrobial activity, with minimum inhibitory concentration (MIC) values ranging from 2.0 to 8.0 μM. This peptide is valuable for antibacterial research, particularly in studies exploring new therapeutic agents against resistant bacterial strains. -
Antimicrobial Peptide
Indolicidin is a potent antimicrobial peptide that targets bacterial cell membranes, disrupting their integrity and leading to cell death. This peptide exhibits significant activity against a broad spectrum of Gram-positive and Gram-negative bacteria, making it a valuable tool in antimicrobial research. Indolicidin is widely used in studies focused on innate immunity, antimicrobial resistance, and the development of novel therapeutic agents against infections. -
Bioactive Peptide
Tet-20 is a bioactive peptide derived from cathelicidins, designed to exhibit potent antimicrobial properties. This synthetic peptide has demonstrated efficacy in preventing biofilm formation and shows broad-spectrum activity against various microbial pathogens both in vivo and in vitro. Additionally, Tet-20 appears to be non-toxic to eukaryotic cells, making it a promising candidate for use in infection-resistant coatings for medical devices. -
Antimicrobial Peptide
Bombinin-like peptide 7 is an antimicrobial peptide derived from Bombina orientalis, exhibiting potent antimicrobial activity against various pathogens. This peptide demonstrates ability to disrupt microbial membranes, leading to cell lysis and death. Its properties make it valuable for research in host defense mechanisms and the development of novel antimicrobial therapies. -
Antimicrobial Peptide
PMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease. -
Peptide
GMPRGA is a peptide that targets spAimR within the bacterial cytosol, facilitating the induction of lysogeny. This compound demonstrates significant biological activity relevant to studies of phage biology and bacterial virulence. GMPRGA is valuable for research into bacterial infection mechanisms and the potential development of novel antimicrobial strategies. -
Collagen Related Peptide
GCO-(GPO)10-GCOG is a collagen-related peptide designed to mimic the structural properties of native collagen through its GPO repeat-containing sequence. This peptide forms a cross-linked triple helix that effectively binds to the Yersinia adhesin YadA, facilitating the adhesion of Yersinia enterocolitica to collagen and other extracellular matrix components. GCO-(GPO)10-GCOG is a valuable tool for investigating YadA-mediated adhesion processes and studying the implications of Yersinia-associated infections in host tissues. -
Peptide Toxin
PSM-mec peptide is a peptide toxin derived from the phenol-soluble modulin (PSM) superfamily, encoded by the psm-mec gene associated with the methicillin resistance gene element (SCCmec). This peptide exhibits pro-inflammatory and cytolytic activities, playing a critical role in biofilm structure regulation. PSM-mec peptide is primarily utilized in research focused on the pathogenic mechanisms and drug resistance linked to Staphylococcus pseudintermedius infections in canines, as well as related zoonotic diseases. -
Synovial-targeted Transduction Peptide
HAP-1 is a synovial-targeted transduction peptide that enables the specific internalization of protein complexes into human and rabbit synovial cells. Its design allows for targeted delivery of therapeutic agents, making it a valuable tool in studies of joint diseases. Additionally, HAP-1 can be fused with an antimicrobial peptide, (KLAK)2, to generate the pro-apoptotic peptide DP2, thereby enhancing its potential for applications in apoptosis research and therapeutic interventions. -
Peptide
SAIRGA is a peptide derived from the phi3T phage that targets and recognizes phAimR in the bacterial cytosol, promoting lysogeny. This compound is valuable for research into bacterial genetics, specifically in the study of phage-bacteria interactions, and may facilitate the development of novel antimicrobial strategies. Its ability to induce lysogenic states makes it an essential tool for understanding phage therapy dynamics and the regulation of bacteriophage life cycles. -
Antimicrobial Peptide
Polistes mastoparan is an antimicrobial peptide that exerts its effect by increasing potassium ion (K+) efflux in Staphylococcus aureus, leading to impaired cell viability. With an effective concentration (EC50) of 5 μM, it serves as a valuable tool for research focused on bacterial cell physiology and antimicrobial mechanisms. This compound is particularly relevant for studies investigating the development of new antimicrobial strategies. -
Bioactive Peptide
BMAP-18 is a bioactive peptide derived from the antimicrobial peptide BMAP-27, belonging to the Cathelicidin family. It exhibits potent bactericidal activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Streptococcus uberis, and Escherichia coli. BMAP-18 demonstrates improved cell selectivity compared to its parental form, showing reduced hemolytic activity while maintaining effective antimicrobial properties. This peptide is suitable for research applications focused on antimicrobial mechanisms and therapeutic strategies against bacterial infections. -
Antibacterial Peptide
Astacidin 1 is an antibacterial peptide that exerts its effects through targeted activity against a wide range of bacterial pathogens. Produced via proteolytic cleavage from hemocyanin under acidic conditions, Astacidin 1 demonstrates broad-spectrum antibacterial activity, effectively inhibiting the growth of both Gram-positive and Gram-negative bacteria. This peptide serves as a valuable tool for antimicrobial research and the development of new therapeutic strategies. -
Antimicrobial Peptide, stable
K11 is a stable antimicrobial peptide that exhibits significant activity against multidrug-resistant and extensively drug-resistant K. pneumoniae isolates, demonstrating a minimum inhibitory concentration (MIC) range of 8-512 μg/mL. This peptide not only inhibits bacterial biofilm formation but also displays synergistic effects when combined with various antibiotics, including chloramphenicol, meropenem, and rifampicin, enhancing the efficacy against drug-resistant strains. K11 maintains high thermal stability and demonstrates effective function across a broad pH range, making it a valuable tool for antimicrobial research and therapeutic applications. -
Peptide
CAP 37 (20-44) is a peptide derived from amino acid residues 20 to 44 of CAP37, a cationic antimicrobial protein. This peptide exhibits significant antimicrobial activity, making it a valuable tool for studying innate immune responses. CAP 37 (20-44) is applicable in research focused on antimicrobial mechanisms and the development of host defense peptides. -
Antimicrobial Peptide
Defensin NP-3A is an antimicrobial peptide derived from human granulocytes, known for its potent cytotoxic activity against various pathogens. It also exhibits anti-adrenocorticotropic hormone (ACTH) effects. This peptide is valuable for research applications focused on innate immunity, antimicrobial activity, and the modulation of endocrine responses. -
Immunogen Peptide
Tetanus toxin peptide is an immunogen peptide derived from the toxin of Clostridium tetani. This peptide has demonstrated utility in inducing diabetes in murine models, making it a valuable tool for studying the mechanisms of type 1 diabetes. Its application in research facilitates a deeper understanding of autoimmune responses and potential therapeutic intervention strategies. -
Polypeptide
LL-37 FKR is a C-terminal fragment of the antimicrobial peptide LL-37, targeting bacterial membranes. This polypeptide exhibits significant antibacterial activity, making it an essential tool in studies focused on innate immunity and antimicrobial resistance. Its role in modulating immune responses also positions it for applications in inflammation and infection research. -
Antimicrobial Peptide
Retrocyclin-3 is an antimicrobial peptide that targets viral infections, specifically human immunodeficiency virus (HIV), influenza A, and herpes simplex virus (HSV). It exhibits potent antiviral activity, making it a valuable tool for research into antiviral therapies and the mechanisms of viral resistance. Its unique structure and function offer insights into the development of novel antimicrobial strategies. -
Antimicrobial Peptide
Palicourein is a 37 amino acid cyclic polypeptide that functions as an antimicrobial peptide. It exhibits potent inhibitory activity against the cytopathic effects of HIV-1RF infection in CEM-SS cells, with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM. This compound is valuable for research applications focused on antiviral activity and the study of peptide-based therapeutics. -
Antimicrobial Peptide
Onc112 is a proline-rich antimicrobial peptide that primarily targets Gram-negative bacteria. It exerts its biological activity by inhibiting translation, specifically by blocking and destabilizing the initiation complex. This mechanism makes Onc112 a valuable tool for research applications focusing on bacterial resistance and the development of novel antimicrobial strategies. -
Antimicrobial Peptide
Mel4 is an antimicrobial peptide that exhibits broad-spectrum antimicrobial activity. It effectively neutralizes bacterial lipopolysaccharide in a dose-dependent manner, making it a valuable tool for investigating the mechanisms underlying bacterial infections. Mel4 can be utilized in research focused on the prevention and treatment of bacterial infectious diseases, including ocular infections. -
Antimicrobial Peptide
Hp1404 is a novel cationic antimicrobial peptide with specific inhibitory activity against Gram-positive bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). This compound exhibits significant antimicrobial activity while maintaining low toxicity and a reduced likelihood of inducing drug resistance. Hp1404 serves as a valuable research tool in the investigation of antimicrobial agents and their mechanisms of action. -
Bioactive Peptide
Lactoferricin H, a bioactive peptide derived from human lactotransferrin (amino acids 37-61), exhibits significant antimicrobial properties. This peptide plays a crucial role in innate immunity, demonstrating the ability to combat a range of microorganisms. Its applications in research include studying host defense mechanisms and developing novel antimicrobial therapies. -
Antimicrobial Peptide
BMAP 28 (bovine) is an antimicrobial peptide known for its potent antibacterial properties. It targets both gram-positive and gram-negative bacteria by disrupting cell membrane integrity, leading to increased permeability and leakage of intracellular contents. Additionally, BMAP 28 demonstrates cytotoxic effects on cancer cells and activated human lymphocytes, inducing apoptosis via depolarization of mitochondrial membrane potential. This peptide is valuable for research applications focused on antimicrobial resistance and cancer therapeutics. -
Antimicrobial Peptide
Maximin S4 is an antimicrobial peptide derived from the skin secretions of the toad Bombina maxima. This peptide exhibits significant antibacterial activity, particularly against mycoplasma species. It serves as a valuable reagent for research into peptide-based antimicrobial strategies and the exploration of innate immune mechanisms. -
Antimicrobial Peptide
Pexiganan acetate is an antimicrobial peptide that disrupts the cell membrane permeability of bacterial cells, leading to their death. This compound exhibits broad-spectrum activity against both Gram-positive and Gram-negative aerobic bacteria, achieving up to 99% inhibition. Pexiganan acetate is primarily utilized in research applications focusing on infections, including those associated with diabetic foot ulcers. -
Antimicrobial Peptide
Cyclic L27-11 is a cyclic peptide antibiotic primarily targeting bacterial outer membrane protein LptD. It exhibits potent nanomolar antibacterial activity against Pseudomonas species, particularly Pseudomonas aeruginosa. By disrupting the transport of lipopolysaccharide (LPS), Cyclic L27-11 leads to the accumulation of membrane-like substances within bacterial cells, ultimately impacting bacterial viability. This compound serves as a valuable tool in the development of new antibacterial agents. -
Antimicrobial Peptide
Dermaseptin-B4 is an antimicrobial peptide that primarily targets microbial cell membranes. It exhibits potent antibacterial, antifungal, and antiviral activities, making it a valuable tool in the study of host defense mechanisms and the development of novel therapeutic agents. Its broad-spectrum activity is especially relevant for research in infectious diseases and antimicrobial resistance. -
Antimicrobial Peptide
Pardaxin P 4 is an antimicrobial peptide that targets and interacts with biomembranes. It exhibits a unique mechanism of inducing cytotoxicity and pore formation by disrupting phospholipid bilayers of varying compositions. This peptide is valuable for research applications focused on developing antimicrobial drugs and exploring membrane-disruptive mechanisms in microbial defense. -
Antimicrobial Peptide
Myxinidin is an antimicrobial peptide that targets bacterial and fungal biofilms. It demonstrates significant activity against biofilms formed by Pseudomonas aeruginosa and various Candida species, effectively inhibiting and eradicating these resilient microbial colonies. Myxinidin is suitable for research applications focusing on infection control and biofilm-related studies. -
Antimicrobial Peptides
Hispidalin is a novel antimicrobial peptide that exhibits broad-spectrum antibacterial and antifungal activity by disrupting microbial membrane integrity. Its mechanism of action makes it a valuable candidate for applications in antibacterial therapeutics and food preservation. Research with Hispidalin may further elucidate its potential in combating resistant strains of pathogens. -
pH-responsive And Self-assembling Peptide
IKFQFHFD is a pH-responsive self-assembling peptide that exhibits biocompatibility at neutral pH. When exposed to acidic conditions, it transforms into an antimicrobial peptide-like structure, demonstrating significant potential in targeting biofilm infections. This peptide can be applied in research focused on chronic wound management, including venous ulcers, diabetic ulcers, and pressure ulcers, offering insights into novel therapeutic strategies. -
Bioactive Peptide
Retro-indolicidin is a bioactive peptide that functions as an antimicrobial agent. This synthetic reverse peptide, derived from indolicidin, consists of 13 amino acid residues and retains significant antimicrobial and protease inhibitory activities in vitro. Retro-indolicidin is applicable in research focused on antimicrobial properties, host defense mechanisms, and potential therapeutic strategies against microbial infections. -
Oligopeptide
Cyclamide is an oligopeptide derived from cyanobacterial algae strains, known for its potential therapeutic effects. It has been studied for its impact on glucose metabolism and insulin regulation, making it relevant for diabetes mellitus research. Cyclamide serves as a valuable tool in the exploration of metabolic disorders and may aid in the development of novel treatments for diabetes. -
Antimicrobial Peptide
Temporin SHF is a broad-spectrum antimicrobial peptide that targets microbial membranes. This peptide effectively combats both Gram-positive and Gram-negative bacteria as well as yeasts, while exhibiting a lack of hemolytic activity. Its mechanism involves disrupting acyl chain stacking within anionic lipid bilayers, resulting in membrane disintegration. Temporin SHF demonstrates significant potential for developing new antimicrobial therapies. -
Antibacterial Peptide
Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment derived from the cell surface adhesin of Streptococcus pyogenes, functioning as an antibacterial peptide. This compound specifically inhibits the interaction between adhesin and salivary receptors, thereby preventing the recolonization of Streptococcus pyogenes. Its potential applications include studies in microbial pathogenesis and the development of novel antimicrobial strategies. -
Immunomodulatory Peptide
IDR-HH2 is an immunomodulatory peptide targeting the host cytokine and chemokine milieu. It facilitates the adhesion of monocytes and THP-1 cells to fibronectin, enhancing immune cell recruitment. Additionally, IDR-HH2 exhibits antibacterial properties, demonstrating inhibitory effects against Pseudomonas aeruginosa and Staphylococcus aureus, with minimum inhibitory concentration (MIC) values of 75 µg/mL and 38 µg/mL, respectively. This peptide is valuable for research in immunology and antimicrobial studies. -
Antimicrobial Peptide
C16G2 is a specific targeted antimicrobial peptide (STAMP) that selectively targets the cariogenic oral pathogen Streptococcus mutans. It disrupts the bacterial cell membrane, resulting in leakage of small molecules and loss of membrane potential, ultimately leading to bacterial cell death. C16G2 demonstrates enhanced selectivity and efficacy against Streptococcus mutans compared to broad-spectrum antimicrobial peptides, making it a valuable tool for research in oral microbiology and infection control. -
Antimicrobial Peptide
Pantinin-2 is an antimicrobial peptide derived from the emperors scorpion (Pandinus imperator), demonstrating potent activity against Gram-positive bacteria. It also exhibits antifungal activity against Candida tropicalis, while displaying low hemolytic activity against human erythrocytes. This peptide serves as a valuable tool in the development of novel antimicrobial agents targeting drug-resistant pathogens. -
Antimicrobial Peptide
MCF is an antimicrobial peptide derived from bee venom, targeting bacterial membranes. It exhibits potent antimicrobial activity against Escherichia coli W 160-37, Staphylococcus aureus 8530, and Bacillus subtilis, with minimum inhibitory concentration (MIC) values ranging from 15-45 μg/ml. MCF is suitable for research applications in microbiology and the development of novel antimicrobial agents. -
Antimicrobial Peptide
Bombolitin III is an antimicrobial peptide that originates from bumblebee venom. It exhibits significant activity by lysing erythrocytes and liposomes, demonstrating a potential mechanism for disrupting microbial cell membranes. This compound is primarily utilized in research applications focused on antimicrobial activity and the study of peptide interactions with biological membranes. -
Polypeptide
D-{Ala-Ala-Ala} is a tripeptide that primarily targets bacterial recognition through its interaction with ristocetin. This compound exhibits key biological activity by enabling the detection of bacteria at low concentrations, making it useful in microbiological assays and research applications focused on bacterial identification. Its ability to facilitate the study of bacterial behavior and responses makes it a valuable tool in the field of microbiology. -
Peptide Sex Pheromone
cCF10 is a peptide sex pheromone that facilitates the transfer of the conjugative plasmid pCF10 from donor to recipient bacterial cells. Its mechanism involves activation of the Opp transport system, allowing cCF10 to enter the cells and inhibit the accumulation of (p)ppGpp, a signaling molecule involved in stress responses. By maintaining a metabolically active state in bacteria, cCF10 effectively reduces the generation of persister cells, making it a valuable tool for research into bacterial conjugation and cell response dynamics. -
Antimicrobial Peptide
Tet-213 is an antimicrobial peptide with broad-spectrum antibacterial activity. It demonstrates the ability to inhibit a wide range of bacterial strains effectively. In addition to its antimicrobial properties, Tet-213 has been shown to promote the repair of infected wounds, making it a valuable tool for research in wound healing and infection control.
