Catalog No.
Product Name
Application
Product Information
Citations
-
Antimicrobial Peptide
Dermaseptin-S5 is an antimicrobial peptide that targets and disrupts the membranes of filamentous fungi. This compound exhibits strong antifungal activity, making it a valuable tool in studies focused on fungal infections and resistance mechanisms. It is particularly useful for research in pharmacology, microbiology, and therapeutic applications involving antifungal agents. -
Antibiotic Peptide
CRAMP-18 (mouse) is an antibiotic peptide that exhibits selective antimicrobial activity without hemolytic properties. It demonstrates effective inhibitory action against Gram-negative bacteria, including Salmonella typhimurium and Pseudomonas aeruginosa. This peptide serves as a valuable tool for research applications in antifungal, antibacterial, and antitumor studies. -
Antimicrobial Peptide
Temporin-SHa is an antimicrobial peptide that exhibits broad-spectrum antibacterial activity, effectively targeting both Gram-positive and Gram-negative bacteria, including drug-resistant strains. With a minimum inhibitory concentration (MIC) of 6.25 μM against Listeria ivanovii and 10 μM against Escherichia coli, it is also active against fungal pathogens such as Candida albicans (MIC = 25 μM) and Saccharomyces cerevisiae (MIC = 12 μM). Furthermore, Temporin-SHa demonstrates efficacy against protozoan parasites, including Leishmania infantum and Trypanosoma cruzi, and exhibits antiviral activity against HSV-1, alongside anti-cancer properties that include cytotoxicity against breast cancer (MCF-7) and lung cancer (H460) cell lines. -
Antimicrobial Peptide
NK-2, an antimicrobial peptide derived from NK-lysin, primarily targets microbial membranes. This potent agent demonstrates significant antimicrobial activity against various pathogens, including Trypanosoma cruzi, Candida albicans, as well as both gram-positive and gram-negative bacteria. NK-2 has been shown to effectively eliminate trypanosomes within the human glioblastoma cell line 86HG39 while preserving the integrity of host cells, making it a valuable tool for research into antimicrobial mechanisms and therapeutic applications. -
Antimicrobial Peptide
Pelteobagrin is an antimicrobial peptide known for its broad-spectrum activity against both Gram-positive and Gram-negative bacteria, as well as fungi, with a minimum inhibitory concentration (MIC) ranging from 2 to 16 μg/mL. Its mechanism of action involves non-competitive disruption of cell wall and cytoplasmic membrane integrity, leading to bactericidal effects. Pelteobagrin holds significant potential for research applications in the study and treatment of infectious diseases. -
Antimicrobial Peptide
EP2 is an antimicrobial peptide that exhibits potent antibacterial and antifungal activities. It effectively inhibits the growth of E. gallinarum, P. pyocyanea, A. baumanii, and K. terrigena, with a minimum inhibitory concentration (MIC) of 11.4 μg/mL. This compound is valuable for research applications focusing on microbial resistance and the development of new antimicrobial agents. -
Cyclic Tetrapeptide
Hirsutide is a cyclic tetrapeptide known for its ability to inhibit chitin synthase, an essential enzyme in fungal cell wall biosynthesis. This compound demonstrates potent antifungal activity against a range of pathogenic fungi, making it a valuable tool for research in mycology and antifungal drug development. Its unique mechanism of action positions Hirsutide as a candidate for studying fungal resistance mechanisms and exploring new therapeutic strategies in treating fungal infections. -
Antimicrobial Peptide
Lasioglossin-III is an antimicrobial peptide derived from the venom of wild bees, primarily targeting bacterial and fungal pathogens. It exhibits potent antibacterial activity against both Gram-positive and Gram-negative bacteria, alongside notable antifungal and antitumor properties. Lasioglossin-III demonstrates cytotoxic effects on various cancer cell lines, including HeLa S3, CRC SW 480, and CCRF-CEM T, with IC50 values of 4, 18, and 5 μM, respectively. This peptide holds promise for research applications in the fields of microbiology, oncology, and drug development. -
Defensin-like Antifungal Peptide
Gymnin is a defensin-like antifungal peptide that exhibits notable antifungal activity against both phytopathogenic and mycotoxigenic fungi. Additionally, Gymnin inhibits HIV-1 reverse transcriptase with an IC50 of 200 μM and suppresses tumor cell proliferation, although it demonstrates only weak mitogenic activity in murine splenocytes. This compound is suitable for research applications related to plant disease treatment and the exploration of antifungal mechanisms. -
Antimicrobial Peptide
Bactenecin is a potent antimicrobial peptide that exhibits activity primarily through its ability to increase membrane permeability in target microorganisms. This 12-amino acid looped peptide, derived from bovine neutrophils, effectively inhibits the growth of a range of bacteria and yeast, including the fungus Trichophyton rubrum. Bactenecin is particularly relevant for research applications focused on bacterial pathogenesis and biofilm formation, as it has been shown to impede the growth and biofilm development of Burkholderia pseudomallei. -
Plant Peptide
Cn-AMP1 is a disulfide-free plant peptide derived from green coconut water, targeting various pathogenic organisms. It exhibits antimicrobial activity against multiple pathogenic bacteria and fungal strains, as well as antitumor effects on cancer cells. Additionally, Cn-AMP1 has been shown to up-regulate inflammatory cytokine secretion in monocytes, making it a valuable reagent for research focused on bacterial infections and cancer therapies. -
Acylpeptide Antibiotic
Cepafungin III is an acylpeptide antibiotic derived from the culture broth of Pseudomonas species. This compound demonstrates significant inhibitory activity against yeast and fungi, as well as exhibiting antitumor properties against P388 leukemia in murine models, particularly when utilized in conjunction with Cepafungin I and II. Its multifaceted biological activity makes Cepafungin III a valuable reagent for research in antifungal and anticancer studies. -
Antifungal Peptide
Coccinin is an antifungal peptide that exerts its bioactivity by inhibiting HIV-1 reverse transcriptase. Isolated from the seeds of large scarlet runner beans, Coccinin demonstrates significant antifungal activity against a range of pathogens, including M. arachidicola, F. oxysporum, P. piricola, B. cinerea, C. comatus, and R. solani, with IC50 values of 75, 81, 89, 109, 122, and 134 μM, respectively. This compound is valuable for research in antifungal therapeutics and HIV-related studies. -
Antifungal Peptide
KK14(R) is an analog of the synthetic antifungal peptide KK14, demonstrating potent antifungal activity against Fusarium culmorum, Penicillium expansum, and Aspergillus niger, with minimum inhibitory concentrations (MICs) of 6.25 μg/mL, 12.5 μg/mL, and 12.5 μg/mL, respectively. This compound also exhibits stability under various heat and pH conditions. Additionally, KK14(R) shows cytotoxic effects on Caco-2 and RAW264.7 cell lines, making it a valuable tool for research in fungal infections and cytotoxicity studies. -
Cyclocarboxyphenate Peptide Analogues
Iso-isariin B is a cyclocarboxyphenate analogue that primarily targets antifungal pathways. This compound exhibits biological activity against a variety of fungi, making it a valuable tool for antifungal research studies. Iso-isariin B can aid in the investigation of mechanisms of antifungal action and the development of therapeutic strategies. -
Antimicrobial Peptide
Balteatide is an antimicrobial peptide derived from the skin secretion of Phyllomedusa baltea, targeting various microbial pathogens. This compound demonstrates significant inhibitory activity against gram-positive Staphylococcus aureus (MIC=435 μM), gram-negative Escherichia coli (MIC=109 μM), and Candida albicans (MIC=27 μM). Notably, Balteatide exhibits no hemolytic activity at concentrations up to 512 mg/L, making it a promising candidate for research in antimicrobial applications. -
Antibiotic/Antimicrobial Peptide
Aurein 2.5 is an antibiotic antimicrobial peptide that exhibits potent antibacterial and antifungal activity. It targets microbial membranes, disrupting their integrity and leading to cell death. This compound is valuable for research applications focused on exploring novel antimicrobial therapies and understanding peptide-microbe interactions. -
Antimicrobial peptide
ToAP2 is a potent antimicrobial peptide that targets fungal cell membranes. It enhances membrane permeability in Candida albicans, leading to significant alterations in fungal cell morphology. This compound is useful in research focused on fungal pathogenesis, antimicrobial drug development, and the mechanisms of peptide-based antimicrobial activity. -
Anti-fungal Peptide
Histatin-8 is an anti-fungal peptide derived from the central sequence of Histatin-3, known for its hemagglutination-inhibiting properties. This peptide exhibits potent antimicrobial activity against various yeast strains, making it an important tool for studying oral thrush and related fungal infections. Its unique mechanism of action and biological significance position Histatin-8 as a valuable reagent in antifungal research applications. -
Antimicrobial Peptide
SP-B peptide is an antimicrobial peptide targeting various fungal pathogens. It demonstrates significant antifungal activity against strains of Cryptococcus neoformans, Candida albicans, and Aspergillus fumigatus. This peptide is useful for research applications focusing on antifungal mechanisms and the development of novel therapeutic strategies against fungal infections. -
Antibacterial Peptide
Metchnikowin is an antibacterial peptide derived from fruit flies, exhibiting potent antimicrobial properties against both bacteria and fungi. Its activity is regulated through the TOLL and IMD signaling pathways, making it a valuable tool for studying immune responses in various infectious conditions. This peptide is widely utilized in research focused on host defense mechanisms and the development of novel antimicrobial agents. -
Anti-bacterial Peptide
Pseudin-2 is an antimicrobial peptide derived from the skin of the South American paradoxical frog, Pseudis paradoxa. It exhibits potent growth inhibition against Gram-negative bacteria, making it a valuable tool for antibacterial research. Pseudin-2 may be utilized in studies aimed at understanding antimicrobial mechanisms and developing new therapeutic strategies against resistant bacterial strains. -
Antimicrobial Peptide
Xenopsin precursor fragment is an antimicrobial peptide that exhibits significant antibacterial and antifungal activity, demonstrated at concentrations ranging from 10 to 500 μg/mL. Additionally, it shows potent anti-protozoal effects, with a minimum inhibitory concentration (MIC) between 2 and 20 μg/mL. This peptide is useful for research applications focused on antimicrobial resistance and the development of novel therapeutic agents against infectious diseases. -
Antimicrobial Peptide
Gageotetrin A is an antimicrobial peptide that targets microbial cells with its potent antifungal properties. Derived from the marine bacterium Bacillus subtilis, Gageotetrin A effectively inhibits fungal growth while demonstrating low toxicity towards various human cancer cell lines. This makes it a valuable candidate for research applications in antimicrobial and anticancer studies. -
Antimicrobial Peptide
BTL peptide is an antimicrobial peptide with potent antifungal properties. It demonstrates effectiveness against various fungal pathogens, including Bipolaris maydis, Alternaria brassicae, Aspergillus niger, and Corynespora personata. This peptide is a valuable tool for research applications aimed at understanding fungal resistance mechanisms and developing novel antifungal therapies. -
Antimicrobial Peptide
Jelleine-I is an antimicrobial peptide known for its broad-spectrum activity against various microorganisms, including yeast, fungi, and both Gram-positive and Gram-negative bacteria. Isolated from royal jelly produced by honeybees, Jelleine-I plays a crucial role in the insect immune response. This peptide is of interest in research related to antimicrobial therapies and the development of novel biocontrol agents in agriculture and medicine. -
Antimicrobial Peptide
Polybia-MP1 is an antimicrobial peptide that targets cell membranes by selectively interacting with phosphatidylserine (PS) and phosphatidylethanolamine (PE). It exhibits notable antibacterial activity against Pseudomonas aeruginosa, along with antifungal and anticancer properties through the induction of necrosis via pore formation. Polybia-MP1 is suitable for research applications related to bacterial and fungal infections as well as cancer studies. -
Antimicrobial Peptide
Dermaseptin-S1 is an antimicrobial peptide that targets membrane integrity in filamentous fungi. Exhibiting potent antifungal activity, it disrupts the cell membrane of target organisms, leading to cell death. This peptide is valuable for research applications focused on developing antifungal therapies and understanding host-pathogen interactions. -
Antimicrobial Peptide
D-Cateslytin is an antimicrobial peptide that demonstrates significant inhibitory activity against Candida albicans, with a minimum inhibitory concentration (MIC) of 2.9 μM. This compound can rapidly penetrate C. albicans cells while exhibiting no cytotoxic effects on human gingival fibroblasts, and it remains stable in saliva. D-Cateslytin is ideal for research on conditions associated with Candida albicans, including oral candidosis. -
Antifungal Peptides
Cyclo(L-Phe-trans-4-OH-L-Pro) is a cyclic peptide that exhibits antifungal activity by disrupting the integrity of fungal cell membranes. This compound is valuable in research focused on developing novel antifungal agents and studying the mechanisms of peptide-based antifungal strategies. Its precise mechanism of action makes it a potential candidate for addressing fungal resistance in clinical settings. -
Antimicrobial Peptide
Temporin L is a potent antimicrobial peptide that primarily targets Gram-negative bacteria and yeast strains. It exhibits significant antimicrobial activity, making it suitable for research applications focused on infection control and antimicrobial resistance. Additionally, Temporin L demonstrates antiendotoxin properties, contributing to its role in studies related to inflammatory responses. -
Tripeptide
IRW is an orally active tripeptide derived from egg white, known for its angiotensin-converting enzyme (ACE) inhibitory properties. This compound exhibits significant potential in preventing high-fat diet-induced non-alcoholic fatty liver disease (NAFLD) by modulating hepatic lipid metabolism and enhancing mitochondrial content. IRW has been shown to reduce hepatic triglyceride levels and lipid droplet size, while also increasing the activity of mitochondrial complexes and citrate synthase. Its ability to activate key pathways, including phosphorylation of 5’-AMP-activated protein kinase and increasing microsomal triglyceride transfer protein abundance, makes IRW a valuable reagent for studies in inflammation and metabolic disorders. -
AJH-1 Short Peptide
H-Tyr-Lys-OH is a dipeptide that serves as a biomarker for AJH-1, displaying significant binding affinity to angiotensin-converting enzyme (ACE). This compound is valuable for research applications involving cardiovascular studies and peptide interaction assays, offering insights into ACE-related biological processes. Its utility in peptide synthesis and characterization enhances its relevance in the field of biochemical research. -
ACE Peptide Substrate
p-Hydroxyhippuryl-His-Leu is a peptide substrate specifically designed for the angiotensin-converting enzyme (ACE). This compound is utilized in biochemical assays to investigate ACE activity and regulation. Its distinctive structure enables efficient cleavage by ACE, making it valuable for research related to cardiovascular physiology and potential therapeutic developments. -
Bioactive Peptide
HD5 is a bioactive peptide derived from human defensin-5, exhibiting lectin-like properties. Secreted by Paneth cells in the crypts of Lieberkuhn, HD5 interacts with glycosylated proteins and lipid components, playing a crucial role in mucosal immunity. Importantly, HD5 is known to competitively inhibit ACE2 receptors on host cells, thereby providing a mechanism to reduce SARS-CoV-2 infection. This peptide has applications in studying antiviral mechanisms and innate immune responses. -
ACE Inhibitory Peptide
Ser-Ala-Pro is an angiotensin-converting enzyme (ACE) inhibitory peptide characterized by an X-Pro structure. This compound exhibits significant potential in the study of hypertension, facilitating research into blood pressure regulation and cardiovascular health. Its mechanism of action makes it a valuable tool for exploring ACE-related pathways in various biological settings. -
TRAF6-p62 Inhibitor
TRAF6 peptide is a selective inhibitor of the TRAF6-p62 interaction. It effectively disrupts the ubiquitination of TrkA in NGF-dependent signaling pathways. This peptide demonstrates significant potential for research in neurological disorders, including Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, traumatic brain injury, epilepsy, and stroke. -
TRAF6 Control Peptide
TRAF6 Control Peptide is a synthetic peptide designed to serve as a control in studies involving Tumor Necrosis Factor Receptor-Associated Factor 6 (TRAF6). This peptide is crucial for validating experimental results related to TRAF6 signaling pathways, which are implicated in immune response and inflammation. Its application extends to research involving ubiquitination processes and the modulation of various cellular functions influenced by TRAF6 activity. -
Bioactive Peptide
LL-37(17-32) is a bioactive peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide LL-37. This peptide has demonstrated the ability to reverse ABCG2-mediated multidrug resistance in various cancer cell lines. Its biological activity makes LL-37(17-32) a valuable tool for research in cancer therapy and drug resistance mechanisms. -
Antimicrobial Peptide
Ranalexin is an antimicrobial peptide that exhibits significant activity against bacterial pathogens. It demonstrates effective inhibition of Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa, with minimum inhibitory concentrations (MICs) of 4, 32, and 128 μg/mL, respectively. Ranalexin is relevant for research applications focused on antimicrobial resistance and the development of peptide-based therapies. -
Antimicrobial Peptide
Arenicin-1 is an antimicrobial peptide derived from the coelomocytes of the marine polychaete Arenicola marina. It exhibits significant antimicrobial activity, with minimum inhibitory concentration (MIC) values ranging from 2.0 to 8.0 μM. This peptide is valuable for antibacterial research, particularly in studies exploring new therapeutic agents against resistant bacterial strains. -
Antimicrobial Peptide
Indolicidin is a potent antimicrobial peptide that targets bacterial cell membranes, disrupting their integrity and leading to cell death. This peptide exhibits significant activity against a broad spectrum of Gram-positive and Gram-negative bacteria, making it a valuable tool in antimicrobial research. Indolicidin is widely used in studies focused on innate immunity, antimicrobial resistance, and the development of novel therapeutic agents against infections. -
Bioactive Peptide
Tet-20 is a bioactive peptide derived from cathelicidins, designed to exhibit potent antimicrobial properties. This synthetic peptide has demonstrated efficacy in preventing biofilm formation and shows broad-spectrum activity against various microbial pathogens both in vivo and in vitro. Additionally, Tet-20 appears to be non-toxic to eukaryotic cells, making it a promising candidate for use in infection-resistant coatings for medical devices. -
Antimicrobial Peptide
Bombinin-like peptide 7 is an antimicrobial peptide derived from Bombina orientalis, exhibiting potent antimicrobial activity against various pathogens. This peptide demonstrates ability to disrupt microbial membranes, leading to cell lysis and death. Its properties make it valuable for research in host defense mechanisms and the development of novel antimicrobial therapies. -
Antimicrobial Peptide
PMAP-36 is an antimicrobial peptide that exhibits potent antimicrobial activity against a wide range of pathogens. Its sequence, GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG, enables it to disrupt microbial membranes, making it an effective agent for combating infections. PMAP-36 is designed for research applications focused on antimicrobial resistance and the development of new therapeutic strategies in infectious disease. -
Peptide
GMPRGA is a peptide that targets spAimR within the bacterial cytosol, facilitating the induction of lysogeny. This compound demonstrates significant biological activity relevant to studies of phage biology and bacterial virulence. GMPRGA is valuable for research into bacterial infection mechanisms and the potential development of novel antimicrobial strategies. -
Collagen Related Peptide
GCO-(GPO)10-GCOG is a collagen-related peptide designed to mimic the structural properties of native collagen through its GPO repeat-containing sequence. This peptide forms a cross-linked triple helix that effectively binds to the Yersinia adhesin YadA, facilitating the adhesion of Yersinia enterocolitica to collagen and other extracellular matrix components. GCO-(GPO)10-GCOG is a valuable tool for investigating YadA-mediated adhesion processes and studying the implications of Yersinia-associated infections in host tissues. -
Peptide Toxin
PSM-mec peptide is a peptide toxin derived from the phenol-soluble modulin (PSM) superfamily, encoded by the psm-mec gene associated with the methicillin resistance gene element (SCCmec). This peptide exhibits pro-inflammatory and cytolytic activities, playing a critical role in biofilm structure regulation. PSM-mec peptide is primarily utilized in research focused on the pathogenic mechanisms and drug resistance linked to Staphylococcus pseudintermedius infections in canines, as well as related zoonotic diseases. -
Synovial-targeted Transduction Peptide
HAP-1 is a synovial-targeted transduction peptide that enables the specific internalization of protein complexes into human and rabbit synovial cells. Its design allows for targeted delivery of therapeutic agents, making it a valuable tool in studies of joint diseases. Additionally, HAP-1 can be fused with an antimicrobial peptide, (KLAK)2, to generate the pro-apoptotic peptide DP2, thereby enhancing its potential for applications in apoptosis research and therapeutic interventions. -
Peptide
SAIRGA is a peptide derived from the phi3T phage that targets and recognizes phAimR in the bacterial cytosol, promoting lysogeny. This compound is valuable for research into bacterial genetics, specifically in the study of phage-bacteria interactions, and may facilitate the development of novel antimicrobial strategies. Its ability to induce lysogenic states makes it an essential tool for understanding phage therapy dynamics and the regulation of bacteriophage life cycles.
