Gliadin Gamma Wheat

Name: Gliadin Gamma Wheat
Brand: Adooq Bioscience
SKU: AP1396
Rating: 5 (288 reviews)

Catalog No.: AP1396

Recombinant Wheat Gliadin Gamma protein produced in E.Coli and fused to a 6 His Tag at C-terminus, having a theoretical Mw of 37945.14 Dalton, pI 7.70.Purified by proprietary chromatographic technique.

Grouped product items
Size	Price	Stock
100µg	$330.00	In stock
500µg	$1,320.00	In stock
1000µg	$2,640.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP1396
Physical appearance	Sterile Filtered clear solution.
Formulation	Gliadin Gamma protein solution (1mg/ml) in 10mM Tris-HCl pH 7.2.
Amino acid sequence	MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH.
Purity	Protein is >90% pure.
Stability	Gliadin Gamma although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source	Escherichia Coli.
Transportation method	Shipped with Ice Packs