ProNGF Human

Name: ProNGF Human
Brand: Adooq Bioscience
SKU: AP2482
Rating: 5 (288 reviews)

Catalog No.: AP2482

Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.

Grouped product items
Size	Price	Stock
2µg	$110.00	In stock
10µg	$290.00	In stock
100µg	$2,200.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP2482
Physical appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	ProNGF was lyophilized from a 0.2 ?M filtered solution of 20mM PB and 250mM NaCl pH 7.2.
Amino acid sequence	MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Uniprot ACC#	P01138
Purity	Greater than 95.0% as determined by SDS-PAGE.
Stability	Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Source	Escherichia Coli.
Synonyms	Human Pro-NGF, ProNGF, NGFB.
Transportation method	Shipped at Room temp