Loading distributor info...
| Catalog Num | AP1993 |
|---|---|
| Physical appearance | Sterile Filtered colorless solution. |
| Formulation | The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT. |
| Amino acid sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL. |
| Uniprot ACC# | P63000 |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Synonyms | P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein, rho family small GTP binding protein Rac1, TC-25, MGC111543. |
| Transportation method | Shipped with Ice Packs |
