SjDX5-271

Name: SjDX5-271
Brand: Adooq Bioscience
SKU: A35346
Rating: 5 (288 reviews)

Catalog No.: A35346

TLR4/MyD88/NF-κB Inhibitor

SjDX5-271 is a small peptide inhibitor targeting the TLR4/MyD88/NF-κB signaling pathway. It is known to induce cell polarization and mitigate hepatic inflammation, demonstrating protective effects against liver ischemia-reperfusion injury in mouse models. This compound is valuable for research in immunology and liver-related inflammation studies.

Skip to the end of the images gallery

SjDX5-271 2767993-76-8 TLR4/MyD88/NF-κB Inhibitor

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
1mg	$185.00	In stock
5mg	$475.00	In stock
10mg	$780.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	SjDX5-271 is a small peptide inhibitor targeting the TLR4/MyD88/NF-κB signaling pathway. It is known to induce cell polarization and mitigate hepatic inflammation, demonstrating protective effects against liver ischemia-reperfusion injury in mouse models. This compound is valuable for research in immunology and liver-related inflammation studies.

Product Information

Catalog Num	A35346
Formula	C137H215N47O49S
Molecular Weight	3336.52
CAS Number	2767993-76-8
Sequence	Tyr-Lys-Asn-Leu-Gly-Gly-Gln-Gln-Gln-Ser-Gly-Ser-Ser-Gln-Gly-Gln-Phe-Pro-Ser-Gly-Gln-Met-Gln-Gln-Gln-Gln-Arg-Pro-Gln-Gln
Sequence shortening	YKNLGGQQQSGSSQGQFPSGQMQQQQRPQQ
SMILES	C([C@H](CC1=CC=CC=C1)NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CC=C(O)C=C2)N)=O)CCCCN)=O)CC(N)=O)=O)CC(C)C)=O)=O)=O)CCC(N)=O)=O)CCC(N)=O)=O)CCC(N)=O)=O)CO)=O)=O)CO)=O)CO)=O)CCC(N)=O)=O)=O)CCC(N)=O)=O)(=O)N3[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(=O)N4[C@H](C(N[C@H](C(N[C@@H](CCC(N)=O)C(O)=O)=O)CCC(N)=O)=O)CCC4)CCCNC(=N)N)=O)CCC(N)=O)=O)CCC(N)=O)=O)CCC(N)=O)=O)CCC(N)=O)=O)CCSC)=O)CCC(N)=O)=O)=O)CO)=O)CCC3

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂