SUMO2 Human

Name: SUMO2 Human
Brand: Adooq Bioscience
SKU: AP2006
Rating: 5 (288 reviews)

Catalog No.: AP2006

SUMO2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.6 kDa.The SUMO-2 is purified by proprietary chromatographic techniques.

Grouped product items
Size	Price	Stock
10µg	$110.00	In stock
50µg	$290.00	In stock
1000µg	$3,960.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP2006
Physical appearance	Sterile filtered colorless solution.
Formulation	The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0).
Amino acid sequence	MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG.
Uniprot ACC#	P61956
Purity	Greater than 95.0% as determined by SDS-PAGE.
Stability	Can be stored at +4C for 1 week. For long term storage , below -20C.Please prevent freeze-thaw cycles.
Source	Escherichia Coli.
Synonyms	Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.
Transportation method	Shipped with Ice Packs