(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)

Name: (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
Brand: Adooq Bioscience
SKU: A23184
Rating: 5 (288 reviews)

Catalog No.: A23184

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand.

Skip to the end of the images gallery

(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) 213779-11-4

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
1mg	$45.00	In stock
5mg	$140.00	In stock
10mg	$235.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand.

Product Information

Catalog Num	A23184
Formula	C194H303N59O53
Molecular Weight	4309.85
CAS Number	213779-11-4
Sequence	Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr
Sequence shortening	AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂