Adrenomedullin (AM) (13-52), human

Catalog No.: A23127
Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.
Grouped product items
Product Name Price Stock Qty
Adrenomedullin (AM) (13-52), human 1mg
$110.00
In stock
Adrenomedullin (AM) (13-52), human 5mg
$305.00
In stock
Adrenomedullin (AM) (13-52), human 10mg
$478.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.
Product Information
Catalog Num A23127
Formula C200H308N58O59S2
Molecular Weight 4533.1
CAS Number 154765-05-6
Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9)
Sequence shortening SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: Cys4-Cys9)
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Adrenomedullin (AM) (13-52), human | Adrenomedullin (AM) (13-52), human Supplier | purchase Adrenomedullin (AM) (13-52), human | Adrenomedullin (AM) (13-52), human cost | Adrenomedullin (AM) (13-52), human manufacturer | order Adrenomedullin (AM) (13-52), human | Adrenomedullin (AM) (13-52), human distributor | buy 154765-05-6 | 154765-05-6 Supplier | purchase 154765-05-6 | 154765-05-6 cost | 154765-05-6 manufacturer | order 154765-05-6 | 154765-05-6 distributor