Adrenomedullin (AM) (22-52), human

Name: Adrenomedullin (AM) (22-52), human
Brand: Adooq Bioscience
SKU: A22750
Rating: 5 (288 reviews)

Catalog No.: A22750

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.

Skip to the end of the images gallery

Adrenomedullin (AM) (22-52), human 159899-65-7

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
500µg	$125.00	In stock
1mg	$190.00	In stock
5mg	$540.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.

Product Information

Catalog Num	A22750
Formula	C159H252N46O48
Molecular Weight	3576.04
CAS Number	159899-65-7
Sequence	Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Sequence shortening	TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Synonyms	22-52-Adrenomedullin (human
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂