Adrenomedullin (AM) (22-52), human

Catalog No.: A22750
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
Grouped product items
Product Name Price Stock Qty
Adrenomedullin (AM) (22-52), human 0.5mg
$132.00
In stock
Adrenomedullin (AM) (22-52), human 1mg
$209.00
In stock
Adrenomedullin (AM) (22-52), human 5mg
$895.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
Product Information
Catalog Num A22750
Formula C159H252N46O48
Molecular Weight 3576.04
CAS Number 159899-65-7
Sequence Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Sequence shortening TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Synonyms 22-52-Adrenomedullin (human
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Adrenomedullin (AM) (22-52), human | Adrenomedullin (AM) (22-52), human Supplier | purchase Adrenomedullin (AM) (22-52), human | Adrenomedullin (AM) (22-52), human cost | Adrenomedullin (AM) (22-52), human manufacturer | order Adrenomedullin (AM) (22-52), human | Adrenomedullin (AM) (22-52), human distributor | buy 159899-65-7 | 159899-65-7 Supplier | purchase 159899-65-7 | 159899-65-7 cost | 159899-65-7 manufacturer | order 159899-65-7 | 159899-65-7 distributor