α-Bungarotoxin

Name: α-Bungarotoxin
Brand: Adooq Bioscience
SKU: A13935
Rating: 5 (288 reviews)

Catalog No.: A13935

nAChR antagonist

α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM.

Skip to the end of the images gallery

α-Bungarotoxin 11032-79-4 <p><strong>nAChR antagonist</strong></p>

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock	Qty
1mg	$305.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description

References

Zhang et al (1994) Neuronal acetylcholine receptors that bind α-bungarotoxin with high affinity function as ligand-gated ion channels. Neuron 12 167 PMID: 7507338

Lopez et al (1998) Unmasking the functions of the chromaffin cell α₇ nicotinic receptor by using short pulses of acetylcholine and selective blockers. Proc.Natl.Acad.Sci.USA 95 14184

Product Information

Catalog Num	A13935
Formula	C338H529N97O105S11
Molecular Weight	7984.12
CAS Number	11032-79-4
Sequence	Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65)
Sequence shortening	IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65)
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂