Signaling Pathway
Important Notice: For research use only. We do not sell to patients.
Not your Region? View all Distributors
| Discription | α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM. |
|---|
| Catalog Num | A13935 |
|---|---|
| Formula | C338H529N97O105S11 |
| Molecular Weight | 7984.12 |
| CAS Number | 11032-79-4 |
| Sequence | Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) |
| Sequence shortening | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) |
Calculate the dilution required to prepare a stock solution. This equation is commonly abbreviated as: C1V1 = C2V2
