Signaling Pathway
Important Notice: For research use only. We do not sell to patients.
Loading distributor info...
| Catalog Num | AP5128 |
|---|---|
| Physical appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | Lyophilized from a 0.2??m filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl. |
| Amino acid sequence | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG. |
| Uniprot ACC# | Q96RJ3 |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Stability | Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Synonyms | TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor. |
| Transportation method | Shipped at Room temp |
